SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G02980.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G02980.1
Domain Number 1 Region: 156-394
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000629
Family Cystathionine synthase-like 0.016
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G02980.1
Domain Number - Region: 734-827,863-890
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0292
Family Cystathionine synthase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G02980.1   Gene: BRADI4G02980   Transcript: BRADI4G02980.1
Sequence length 911
Comment pep:novel chromosome:Brachy1.0:4:2223452:2226509:1 gene:BRADI4G02980 transcript:BRADI4G02980.1
Sequence
MHLSLWKPLSHCAAILLAKNHRRRGGGGGGGGGGGGHGSNGRRDDPSSFLRQLRDALDAA
SEEGSLCPPPDAQAGADADAAVTRSRSLARLRAQRDFLRATGLAAAAGPFRSPSDLPLLA
HAIATFLSMYPEYASTSDVDRLRLDHYSHLDAPGAGRVCLDYCGFGLFDSSWDSSSSCFT
LSELNANLSNHALYGGAEPGTAENDIKERILEYLNVPASEYALVFTVSRGSAFKLLAECY
PFESNRRLLTMFDHESQSVNWMAQSARAKGAKTRTALFRWPTLKLCSTELRKEIVGKRKG
RRRDAAAGLFVFPAQSRVTGAKYSYQWMALAQQNGWHVMLDAGALGPKDMDSLGLSLFRP
DFIITSFYRVFGADPTGFGCLLIKKSVIGILQGRNGCNASGMVKIVPVFPQYLSDSIDEF
DALEADGLEDDSGAPKDENPVSDVRNGSQLPAFSGVYTSAQVRETFDCDPGRDSSSDRDG
ASTIFEETENLSVGEVMRSPAFSEDCSSENSFWVDVGQSPLGSEKSGQFKKGKLGSPLPS
SWFTGRKNNKRMSPNLASRISRSPLYDGNVISFDAAVLSVSQDVDCLREDPDEEILENGR
RNHFRQVSEIQEEPEVEEVACRHAMNGGVDHKESAIRRETEGEFRLLGGRDGNSRFTGGR
LFGVEEIDGGISMGRRVSFNTEANMIADRLHRASDAAEASGYPFRDDDGCISDGYDDDAQ
DWSRREPEIVCRHIDHVDMMGLNRTTLRLRYLINWLVTSLLQLRLPGSKDVDGVPLVHIY
GPKIKYERGAAVAFNLKQSDGTFINAEVVQKIAEKNCISLGIGFLSHIKIDPNQKQSNGA
LDIPEATLYKNGRRDSKKVTLRVEVVTASLGFLTNFEDVYKMWAFVAKFLDPSFLESERL
AIATDHSEGQI
Download sequence
Identical sequences I1IGX5
15368.BRADI4G02980.1 EG:BRADI4G02980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]