SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G15030.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G15030.1
Domain Number 1 Region: 14-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-64
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 400-491
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000396
Family Thioltransferase 0.083
Further Details:      
 
Domain Number 3 Region: 507-598
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000658
Family ArsC-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G15030.1   Gene: BRADI4G15030   Transcript: BRADI4G15030.1
Sequence length 598
Comment pep:novel chromosome:Brachy1.0:4:15692600:15698242:-1 gene:BRADI4G15030 transcript:BRADI4G15030.1
Sequence
MGSKLPQSQRQTDIDEITGNYSMELGRGGYGVVYKGKDKDGEEIAVKVLQERTGGNHDEE
FNKEFYSLLELRHPNIILLVGYCYETEKRINNFTKKFDEIIRAALCFEYAPNGNLRNYIS
DDDDRLDWHTRYNIIKGTCEGLHYLHHHPSGPIYHLDLKPENILLSRNMVPKIADFGMSR
LFSDKTTKVTASPMGTWRYQPLEYKKGGTVSKDFDVYSLGVIIIEIVVGSETYNDIDEFS
DSQEIFEFADKKWRSKLKKTETYKSLEAYCEQVKTCLEIALKCMENKRSKRPTIIDIISN
LNEVESKTPKRNSVVQESRKDSGSSTQQFRSMPSTWTPDKANYKNTRMGIDRPEKLRGST
SLDSSRDNTRNIQDGSAVIRQNKTRQYFSTGGKGSSSEDSSNKLVLYVTGQGKPGTLDDC
DDIRSALEVLRLRFIEKDLFDNPGNLRELKRLCGATIPTRPPALSIAGEQVIGAEDLMEL
HNEGKLAALLKCTPGLPPRRAKGGAKEAADKDVVVLYVTSQGKEGTLDDCSRVRLALKSA
RIDFVEKDLFNNRDTLRELQRLSDSARPPTLCINGENVVNTQTLLKLCDQRRIATLFK
Download sequence
Identical sequences I1IKS4
15368.BRADI4G15030.1 XP_010237598.1.954 XP_010237599.1.954 EG:BRADI4G15030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]