SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G20610.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G20610.1
Domain Number 1 Region: 313-451
Classification Level Classification E-value
Superfamily ApaG-like 6.8e-29
Family ApaG-like 0.0004
Further Details:      
 
Domain Number 2 Region: 20-84
Classification Level Classification E-value
Superfamily F-box domain 0.00000249
Family F-box domain 0.013
Further Details:      
 
Domain Number 3 Region: 103-203
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000111
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G20610.1   Gene: BRADI4G20610   Transcript: BRADI4G20610.1
Sequence length 451
Comment pep:novel chromosome:Brachy1.0:4:23716379:23721427:1 gene:BRADI4G20610 transcript:BRADI4G20610.1
Sequence
MAAPPPEPAGAVRLESLEGLILDTVISKAGARTAAALACTSTHLRTAVDEDAVWRRFCAQ
DLGLDAPLDPEDRPLPSFKDAYKAWLVSFGMYPLPLVKRVKLFWTSLKSWLSENFPEALR
TLNKGVSEAQIRSAEDDLGFKLPMPTKLLYRFCNGQLPFTGDHFEDVRMAPLGIIGGYVF
YNHCVNVHLSSLEQIVEATKEFYLELNEQGVFNELKLALVATSWYHPKAFLLNCSNGELY
VGTANLPGGEMMSCVPKSLIKPTNNDMPQDGLLLWLEEHLRRLQTGMIKTRPLKTSRYIC
LYPEGTPSCTSATTNGVKVRASAVFAPEHPHSQGHGRRHIYSYSIRLSVPEAIMLGGVYY
SSCQLQSRHWIIRCRDRVVSDVHGEGVIGKYPSLLPGQEEFVYESCTPLNGSPGSVEGSF
TFVPGRLTRPEGKPFDVTVAPFPLETPEYIF
Download sequence
Identical sequences I1IM35
15368.BRADI4G20610.1 EG:BRADI4G20610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]