SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G22670.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G22670.1
Domain Number 1 Region: 69-411,457-481
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.3e-37
Family Cystathionine synthase-like 0.02
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G22670.1
Domain Number - Region: 450-526
Classification Level Classification E-value
Superfamily Xylose isomerase-like 0.0447
Family IolI-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G22670.1   Gene: BRADI4G22670   Transcript: BRADI4G22670.1
Sequence length 586
Comment pep:novel chromosome:Brachy1.0:4:27126366:27129961:1 gene:BRADI4G22670 transcript:BRADI4G22670.1
Sequence
MPSLGAVMADGREATATATTMKDTATMVASKTKKTTLLSLLRAKSERRAEAEEKVEWVRS
QIIGGDAELDTPFGRRALVYADHTASGRGLRYVEDYLLTHVLPFYGNTHTEDSYVGSRTT
RTLCGASNYIKRRTGAGDGVALLFCGSGTTAAIKRLQEATGIAAPPGLPRARVVALRPEE
RWVVFVGPYEHHSNLLSWRQSLADVVEVGAGGGEDGGGLVVDLAALRRALGSPEYADRPM
LGSFSACSNVTGILTDTRAIARVLHQHGAFACFDFAASAPYVEIDMRPGEMDGYDAIFLS
PHKFPGGAPGTPGILLMSRALYVLGARSMPPSPCGSATVSYVNGANECDTVYLDGMEEHE
AAGRRLWPRRCAPLSRSGSRSGSSGSVLLPFGSVPTPMPPCVGSCGTPASRCLGMLRQEV
AHLLLPRLPRRWRWSHGDGEEDKTTAPPWAGYHGVKPGWTRVSFAYYMPREEFRFILATI
DFVAEHGHRFLPLYAFDWATGNWTFRRRAVKHHLIMEELLHLGGADEARRTTKEESKTDD
DDKFKSYLELATKVALSLPDTTSCDPRQVASRLPEGIDPDIVLFRV
Download sequence
Identical sequences I1IMN2
EG:BRADI4G22670.1 15368.BRADI4G22670.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]