SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G34270.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G34270.1
Domain Number 1 Region: 590-784,812-977
Classification Level Classification E-value
Superfamily DNase I-like 4.03e-57
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000242
Further Details:      
 
Domain Number 2 Region: 227-254,287-328,399-410,478-589
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.49e-20
Family WD40-repeat 0.0051
Further Details:      
 
Domain Number 3 Region: 163-273,304-411
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000165
Family WD40-repeat 0.016
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G34270.1
Domain Number - Region: 1052-1082
Classification Level Classification E-value
Superfamily PapD-like 0.0157
Family MSP-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G34270.1   Gene: BRADI4G34270   Transcript: BRADI4G34270.1
Sequence length 1187
Comment pep:novel chromosome:Brachy1.0:4:39934015:39940359:1 gene:BRADI4G34270 transcript:BRADI4G34270.1
Sequence
MEPDDEALKELAASASRPPQRRGISYSQPLSRGDAASARRAALRNHSLDDEHILPASHSL
SYTHHDPSAGVPAGYHPPLPPHQQQQHHHPSASYSSGPSSRRSMGGASDGSMTLERAMSE
YGGGHGTLPEFVGAGGGKGIFRVPLRAAMHPLRPPPLEVRPHPLRETQAGSFLRTLAAEP
QRRQLWAGAESGIRVWALDEVFAGWGAGARRGDEESAPFREGVPAAPALCVALDRANGLL
WTGHKDGRIRSWRMDLETAATAPAPPPPGSGDGGGSVGGSAHGGSNSAPVFREALTWQAY
GRTPVLSMAVTSYGEIWSGSEGGVIKAWPYDAIAKSLSLSPEERHMAALLVERAYIDLRN
HCTVGNVCSLPASDVKYMLSDHSRAKVWTVTSMTFALWDARTRELLKVFGMDGQVESARL
ETPVMPEQPMEEVEVKVKPSKKDKSQGGSLNFFQKSRNALMGAADAVRRVATKGTFVEDN
RRTGAVAQVNDGTIWSGCTNGSIIQWDGNGNRMQEFQYHTSSVQCIKSLGDRVWVGYASG
TVQVMDIEGTLLAGWTGHSCPVIRMAIGGSYIYTLAHHGGIRGWPLTSPGPLDDILRTEL
ANRELSYTRMEKINIMVGSWNVAQGKASAESLKAWLGSVSSDVGLVVVGLQEVEMGAGFL
AISAAKETVGLEGSANGQWWIDNIGKALDEGTSFHRVGSRQLAALLIAAWARKSLKPYVG
DVDAAAVPCGLGRAIGNKGGVGLRIRVYDRKMCFVSNHFAAHLEAVGRRNADFDHIYRTM
AFNKPHGSTGSATSVQLHRTVNVNGNQVDEFRPDLAEADMVVFLGDFNYRLYGITYDEAR
DMVSQRSFDWLREKDQLRVEMKAGKVFQGMREGLIKFPPTYKFQKHQPGLGGYDSGEKKR
IPAWCDRVLYRDSRAVSVAECSLECPVVAAITSYVACMEVTESDHKPVRCTFSVDIARVD
ELVRRQEYGEIIESNEEVRSMLKESCFVPDTTVSTDEIILENQENIVFQITNNCETSKAS
FEILCEGQSTKKEDGTKSEIVPRASFGFPLWLEVQPAVGLIKPGESMEITIHHEDFYTQE
EFVDGIPQNWWCEDTRDKEAVLIVNITGSTSTETKTHRINIRHQCPATSAPPTIINPPVS
ATPPSNALTSEVSSKRSSKKSQTNRQQQDYAQFGSSEVHDLCRMRCP
Download sequence
Identical sequences I1IRG9
15368.BRADI4G34270.1 EG:BRADI4G34270.1 XP_010238328.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]