SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G36410.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G36410.1
Domain Number 1 Region: 33-251
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 8.37e-74
Family Osmotin, thaumatin-like protein 0.00000278
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G36410.1
Domain Number - Region: 228-293
Classification Level Classification E-value
Superfamily TNF-like 0.0456
Family TNF-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G36410.1   Gene: BRADI4G36410   Transcript: BRADI4G36410.1
Sequence length 322
Comment pep:novel chromosome:Brachy1.0:4:41643552:41645322:1 gene:BRADI4G36410 transcript:BRADI4G36410.1
Sequence
MASSAASSSSIVWRLLFVFMSFFQGTTLVSGATTFTFTNRCGGTVWPGVLANAGSPALDT
TGFALVSGESRSLSAPPGWSGRFWARTGCAFDSDAGSGKCATGDCGTGEAECHGAGAAPP
ATLIEFTLAGAGAPKQDDYYDVSLVDGYNVPVVVEAAGCPATGCAADLDERCPPELRATG
GSGCRSACEAFGRPEDCCSGPEFGSPGACRPSAYSQVFKAACPRAYSYAYDDATSTFTCS
GSGAYSVTFCPRAGATLSSQKSSMDPTMPRPNDLDDSARLAADSWLASLATGETDAATTM
TAASAFQAALAAATVVALLVSH
Download sequence
Identical sequences I1IS93
EG:BRADI4G36410.1 15368.BRADI4G36410.1 XP_003576776.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]