SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G37740.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G37740.1
Domain Number 1 Region: 410-603
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.77e-34
Family cAMP-binding domain 0.000017
Further Details:      
 
Domain Number 2 Region: 73-276,343-403
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-18
Family Voltage-gated potassium channels 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G37740.1   Gene: BRADI4G37740   Transcript: BRADI4G37740.1
Sequence length 714
Comment pep:novel chromosome:Brachy1.0:4:42814832:42819740:1 gene:BRADI4G37740 transcript:BRADI4G37740.1
Sequence
MFGSRVQDEVEMQRRTTNRIFPDERQDQFKLPYQAARADRFGANRIDGKNLEKHKLLSEG
NKSWHHRILDPGSSMLLTWNRVYLMACLFALFIDPFFYYLPLVRKETSESDSISCVTKDQ
RLSVTITVLRSLADLFYMLNIAIKFHTAYVDPKSRVLGKGELVVDLKKIQQRYFRTDFCI
DLLAAVPLPQITVGLVLPAIKRSDYNVQTTTFALVIVIQYVLRMYLIYPLSNQIIKAAGV
VAKSAWGGAAYNLLLYMLASHITGAIYYLLSIERQITCWNQQCLAESSCNLGFISCDNAG
LSSYLGWKSKTKIFYNCDATANSSQLQLDYGMFSNALTKGAVSTSFLEKYFFCLWWGLLQ
LSSSGNPLQTSAFIVENVFAIAIGAVSLILFAQLIGKMQTYLQSVSKRLEEWRLRQRDME
EWMRHHQLPSYLQERVQRFVQVKWLATRGVEEESILQALPADIRRDVQRHLCLDLVRRVP
FFAEMDDQLLDAICERLVSFLCPEGTYISREGDPVNEMLFIIRGKLESSTTNGGRSNFFN
SILLRPGEFAGEELLTWALLPKTNVHFPLSTRTVRSLTEVEAFALRAEDLKFVANQFRRL
HSKKLQHTFRFYSHHWRTWAACFIQAAWRQHQRRKLAESLSRWESYSSWWSEDHPAADKP
KQEGTSSGTRTTAEGAIAQMHKLASASRRFRADDTMIRRLQKPDEPDFSADHFD
Download sequence
Identical sequences I1ISR4
15368.BRADI4G37740.1 EG:BRADI4G37740.1 XP_003578631.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]