SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G38690.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G38690.1
Domain Number 1 Region: 470-744
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.65e-72
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 759-834
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-19
Family U-box 0.0019
Further Details:      
 
Domain Number 3 Region: 47-186
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000435
Family Universal stress protein-like 0.025
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G38690.1
Domain Number - Region: 328-460
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000272
Family FCH domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G38690.1   Gene: BRADI4G38690   Transcript: BRADI4G38690.1
Sequence length 836
Comment pep:novel chromosome:Brachy1.0:4:43522143:43527713:1 gene:BRADI4G38690 transcript:BRADI4G38690.1
Sequence
MFMRGGSGRSSNGSGTNRSASLREIDEEAATISEPEEDNDSGGKLHVAVGKDLKDSRSSL
IWAAGNLLHGGDLRLVLLHVHQPAERIMNGLCKVPASHLEEKELRAYRRIEKDDMDALLN
QYLNFCRISLKVQAETLVIEKNTPAHGIIELIDKYHITKLVMGTSSVSVKRNIPKSKVAA
SVHLQAKPYCQIFYVSKETLACSREATQLSVKPESPRSSCASSLSDQSEFPARSASLPPG
HPGFLGSADQEALPRRSNSVSYPLSGSIVDSVENLSLARRQSIDMTSTVFSPNSSQQSTV
GSSLDLKDLDSMDGSPTPVSIAISEHQHSMVETVIQNEVFEQLHRVRNELERSRKEASEG
RQKAEKDLYEASMKFRARENSLCREKKEVEERLTREKAGLEKEHLNICNELQKANGKRAE
LENKLLQANCRIEELQQLQGELQCEKDHAVREAEEMRQINGNIVFGSTGAVALTEFSYTE
IKEATSDFDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRH
PNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHS
NKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDP
GYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPE
YTEELARLALRCCRYDRKKRPDLANEAWGVLQAMINYPDDKSATPSFFICPMTQEIMRDP
HIAADGFTYEGEAIKDWLQRGHKMSPTIYLDLAHHELIPNNALRFAIQEWQMQQKP
Download sequence
Identical sequences I1IT34
EG:BRADI4G38690.1 15368.BRADI4G38690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]