SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G41920.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G41920.1
Domain Number 1 Region: 519-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-76
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 111-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-24
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Domain Number 3 Region: 394-436
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000471
Family Hairpin loop containing domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G41920.1   Gene: BRADI4G41920   Transcript: BRADI4G41920.1
Sequence length 846
Comment pep:novel chromosome:Brachy1.0:4:45936204:45939221:-1 gene:BRADI4G41920 transcript:BRADI4G41920.1
Sequence
MGLSNLFLCILLATAAAPALVVLSVAQRYDYPTANLSTLWINNKDSLPHSVSYTDGSAVR
AIVLRSPQTFFGPSFAAGFFCASPCSVFLFAVFIVYTNSGARITMPTTGIPRVVWSANRA
RPVKENATLELSSDGNLLLRDADGALVWSSSSSGRSVAGMVITDFGNLALVDLKNATVWQ
SFDHPTDALVPGQSLVEGKRLVASTSATNWTESHLYMTVLPNGLSAYVGSAPPQLYFSQL
VNTNKTGNSRTEVIFTNGSLSIFVQPKQPNDPDASIQLTAARSTQYMRLESDGHLRLYEW
LVDELSDSVGKWTVVSDVIKIFPDDCAFPTVCGEYGICTGGQCVCPLENNSSSSYFKPVD
DRKANLGCDPVTPISCQEMQRHQLLTLTDVSYFDASHTIVNATNRDDCKQACLNNCSCRA
VMFRYGQNDSDGKCLWVTKVFSLQSIQQEIVHYNSSAYLKVQLRPATSVSDPTKKKVILG
AALGAFTTLILLVIVVALYVIRKGKYQELDEELDFDQLPGMTMRYSFDTMRECTEDFSKK
LGEGGFGTVFEGKLGEVRVAVKRLEGARQGKKEFLAEVETIGSIEHINLVRLIGFCAEKS
QRLLVYEYMPRGSLDRWIYYRHNNAPLDWCTRGRIILDIAKGLCYLHEECRRIIAHLDIK
PQNILLDENFHAKVADFGLSKLIDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFG
VVVMEVICGRKNIDISLPEESVQLINLLQEKAQSNQLIDMVDKNSEDMVLHQEEAVQVMK
LAMWCLQNDSNKRPSMSSVVKVLEGSMDIETSIDCIFLNANTVMPAQHNQSTNSVPPQAS
VLSGPR
Download sequence
Identical sequences I1IU59
15368.BRADI4G41920.1 EG:BRADI4G41920.1 XP_003578879.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]