SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G44390.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G44390.2
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily Chalcone isomerase 6.02e-29
Family Chalcone isomerase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G44390.2   Gene: BRADI4G44390   Transcript: BRADI4G44390.2
Sequence length 156
Comment pep:novel chromosome:Brachy1.0:4:47813451:47815129:1 gene:BRADI4G44390 transcript:BRADI4G44390.2
Sequence
MEHLQSWKGKDQLQVEDDAFFSALVSAPVEKVLRVVVIKEIKGSQYGVQLESSVRDRLVA
ADRYDDDEEEALEKVAEFFQSKYFRPGSVVTFHFPATATAAEISFATEGKDEAKVAVENA
AVAEMIQRWYLGGASAVSQTTVRSLADHFTALLSSP
Download sequence
Identical sequences I1IV07
EG:BRADI4G44390.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]