SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G00430.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G00430.1
Domain Number 1 Region: 927-1144,1242-1309
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000252
Family WD40-repeat 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G00430.1   Gene: BRADI5G00430   Transcript: BRADI5G00430.1
Sequence length 1314
Comment pep:novel chromosome:Brachy1.0:5:385630:399933:1 gene:BRADI5G00430 transcript:BRADI5G00430.1
Sequence
MAADEADGDRFIEIVSTGALYRGGQAQWERKYWSCSRGKHRYPYPVGYHAVRRYSGISYT
MEIQQGPRGPVFQVTSTLGDSATGPTPDIAWKNFHKKMGSKVRNWQRTRSFPQKIDGVEA
CSCLYNFSKTLFGFKNASVQRLLRQLIVHSSGFGTKMPCPNNSGAASPLTHTVAVDVSDD
YEEQLVSLDKTVGTAKRSINPIHEESVAKRIHSQDILSSVNNCNDELDKSRESSDKFIVE
RPVFDSNAYFSMFKGGPGSNTQLRDVSGSRCMPPLLEEIPRDSKCTRVDDTLGEYVPSSS
QEDGLFSGSYSSSEKADLESAENEVAKSMMTSLPPQTIPLLKKTQVDDTLREYVPSSSQE
DGLFSSSYSSSEKADLESAENEVAQSMMTSLLPQTIPLLKRTRVDDTLGEYVLSSSQEDG
LFSSSYLSSEKADLESAKKEVSKSMMTSLLPQTIPLLKRTRVDDTLGEYVLSSSQEDGLF
SSSYLSSEKADLESAENEVAKSMMTSLLPQTIPLLKKTCIKKKVKQKGNARYRALIRTAS
AQNPSADDCQGVSLPASIREGNMNSSQTHIHGRLLHETIKDSGTNKDCMNDEQVIKSDME
AFVADSFEDDAHIWCDNTSKAMGAQHHESDDACSREPNENSIKDSGTNNDCMNDEKVIES
DMEAFVADSFEDDAQIWGDSTSKAMGAQHHESDDGCSREPNENSIKESGTNNDCMNDEQV
IKSDMEAFVADSFEDDAQVWGDNTSKTMGAHHHESDDACSREPNENSKLLLSKRETNAEL
SECQVQAHDSADDTPDMIYDHDKGQYILSDAYLAFLEEEFGLNDSSHPAHFNHVDNDAEP
NQPKDPKEGIANGSLLSVDGSDHMNMCNKHNVFHNQVDHTLCNINHVNGLPSKHPKTSIR
GSAHHLELTASYLHPMPVLSIMLNTKSINSLHIYVLCGFLASCQRFLYVYNITLKDYPDE
PPYFVGYTSLLLPSLEQASTGNFTFGRSGMQFTPDGQFLILLSSIRLPCCRMQNIDCSCS
LCKFDQHDDNSLKIVSVNCGYSSLLTKLMPYGTVSSFLICEPNYVVAAEDSRKLHIWKMV
AGWSVVSEEYVISSLGNVGPSILELKRMPKSSSLIIGHDCAGGFCLWDISKRALLSTFAA
PGNIVFQILPLGICSVHEDIFHASVDDIERRLQEITVTGVSRKDDKESTLMLSGKDIAVW
IMVSAASVAEYQHDLRAKEHNARWRLALLANKKVIMGNIFDPRATSIDVSGNYGFAGTYG
GCLYMWELSSGRKLAGTECFNGQRVSCVAVDAKSRVVAVADDDCNVLLYTENMV
Download sequence
Identical sequences I1IVD9
15368.BRADI5G00430.1 EG:BRADI5G00430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]