SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G01990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G01990.1
Domain Number 1 Region: 64-274,337-384
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.12e-27
Family WD40-repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G01990.1   Gene: BRADI5G01990   Transcript: BRADI5G01990.1
Sequence length 417
Comment pep:novel chromosome:Brachy1.0:5:2079414:2087518:1 gene:BRADI5G01990 transcript:BRADI5G01990.1
Sequence
MAGGGGDNTAPGMAMEVEAQASPCPGPSPPPLSGSPTPSSDSGSNSVASSMRLGLRNSIQ
TNFGDDYVFQIASCQEISTLAVSLSTNALKFYSPATGQYLGECTGHIGTIHEISFSAPSS
PHVVCSSSSDGTVRAWDTRCYKQISLLSGGASHEMFSFSFGGSSGNLLAAGSNSQVLLWD
WRSSKQLACLEESHMDDVTQVRFAPNQQSRLISAAVDGLVCVFDTDGDIDEDNHLLSVMN
VETSVAKVGFYGNMYQKLWCLTHIETLSTWDWNEGNRELNIEDARSLATDKWNLDHVDYF
VDCHYSLPDDRLWAIGGTSAGTLGYFPVKNDPAGVIGSAEAILEGGHTGVIRTIYPAGSS
HQNLGQNRGIFGWTGGEDGRLCCWRSEETAAANKSWISSMLVSRAQKRIRSSRHQPY
Download sequence
Identical sequences I1IVU8
15368.BRADI5G01990.1 EG:BRADI5G01990.1 XP_003580639.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]