SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G04000.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G04000.1
Domain Number 1 Region: 54-425
Classification Level Classification E-value
Superfamily L domain-like 7.48e-62
Family Polygalacturonase inhibiting protein PGIP 0.0046
Further Details:      
 
Domain Number 2 Region: 742-1050
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-59
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 3 Region: 430-684
Classification Level Classification E-value
Superfamily L domain-like 3.06e-52
Family Polygalacturonase inhibiting protein PGIP 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G04000.1   Gene: BRADI5G04000   Transcript: BRADI5G04000.1
Sequence length 1064
Comment pep:novel chromosome:Brachy1.0:5:5165345:5168884:1 gene:BRADI5G04000 transcript:BRADI5G04000.1
Sequence
MAPQVLGSKSRFAPSCHAPFLLCSLLIFLSSNTIILSSAQASNSSESDRQALLCFKSGIS
KDPAGVLGSWRNDSLNFCSWQGVNCSITLPIRAVSIEFKSMRLTGTLSGCLAALTSLVQM
NLQNNKLSGSIPDEIAELQNLQILMLAGNRLAGIIPLSLGTAASLRYVNLANNSLSGVIP
DSLSNSSSLSEIILSRNNLSGVIPTNLFKSSKLVTVDLRWNALSGPIPQFEKMAALQVLD
LTGNLLSGTIPTSLGNVSSLRSIVLSQNNLQGPIPETLGQIPNLQMLDLSQNIFSGYVPD
TIYNVSSLRIFDLGINNFNGRMPSRIGHSLPNLQTLVMRGNRFSGSIPDSLTNMSKLQVL
DLSINLLTGVIPSFGSSVNLNQLLLGNNNLEADDWAFLTSLSNCTQLLRLAMDGNILNGS
IPESVGNLSRKLERLNFGQNQISGNIPAEIGNLVNLTLLDMGQNMLLGQIPLTIWNLTNL
FVLKLSMNRLSGQIPSTVGNLLQLGHLYLDDNELSGNIPPNIGQCKRLLMLNFSANHFNG
SIPIELVGISSLSLGLDLSNNNLTGPMPQQVGNLINLGLLSVSNNRLSGGLPAGLGQCVQ
LLSLHMEHNMFSGNISEDFRALKNIQQIDLSENNLTGQVPEFFENFTSLNVNISYNKFEG
PIPTGGIFQNSKVVSLQGNIGLCEKAAAIFELPICPTTPTSPATNRRSHARLILISIPLV
IIALFAFLYALVTVMKGTETQPPENFKETKKRVSYGDILKATSWFSLVNRISSSHTASVY
IGRFEFETDLVAIKTFHLSEKGSQNSFFTECKVLKHTRHRNLVQAITCCSTVNFENNEFK
AIVYEFMANGSLDMWIHARLHQGSPRRLLTLGQRISIAADVASALDYLQNQLIPPLVHCD
LKPSNVLLDYDMTSRIGDFGSAKFLSSSLGGPEGLAGVGGTIGYIAPEYGMGCKISTGGD
VYSFGVLLLEMLTAMRPTDAVCGNALSLHKYVDLAFPDRIADILDPHMSYGEDELAASLC
MQNYIIPLVGIGLACSAESPKDRPAMQDVCGKIVDIKEAFVQTP
Download sequence
Identical sequences I1IWG7
XP_003581467.1.954 EG:BRADI5G04000.1 15368.BRADI5G04000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]