SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G07810.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G07810.1
Domain Number 1 Region: 67-129
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000089
Family F-box domain 0.0075
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G07810.1
Domain Number - Region: 189-421
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00301
Family Tricorn protease domain 2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G07810.1   Gene: BRADI5G07810   Transcript: BRADI5G07810.1
Sequence length 450
Comment pep:novel chromosome:Brachy1.0:5:10301207:10304129:1 gene:BRADI5G07810 transcript:BRADI5G07810.1
Sequence
MAGSVDLEFEFDMEVELDPNLRSEMGHADMELNLASVLNGEDVQASEDKQDHQHFQEHSL
IPQPQPPVAAAATLPDDILFSEVLVRLPVKSLMRFKCVCPSWCAAIADADFIRRHLDHSR
GIMPSILVTPRESSGDDDDDDEFSEDISFHRLQLEQALAGTIMEELMLKKVSPDQEDGIT
NKIFLTHCDGLVAITTTTNQVFVCNPATQEFVALPTRTPDFDSDEYSNEPTTAALGFDPH
RNRYVVARYFYKPTSSSEDNNNMGHEVFWLGGDSTWSWKPTQDPPLPIYQTRPAFMGGAF
YWKSADQSLLRFSLGDEAFEVIPPPPGASSHYTLESLTELDGNLCHTYTSSQTKFEVWQL
ADDRSSWSKRCQVINFDLSFGSEAFLPVWAGRGGMLLAVDYNKLYWYCDKSGSLKKVVDM
EHEVDLGRREDGFYRQQIVPYIESLVSIRK
Download sequence
Identical sequences I1IX19
EG:BRADI5G07810.1 15368.BRADI5G07810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]