SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G19770.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G19770.1
Domain Number 1 Region: 21-69
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000183
Family F-box domain 0.0069
Further Details:      
 
Domain Number 2 Region: 444-488
Classification Level Classification E-value
Superfamily F-box domain 0.0000000196
Family F-box domain 0.0093
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G19770.1
Domain Number - Region: 122-157,365-405
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0811
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G19770.1   Gene: BRADI5G19770   Transcript: BRADI5G19770.1
Sequence length 958
Comment pep:novel chromosome:Brachy1.0:5:22708840:22711716:1 gene:BRADI5G19770 transcript:BRADI5G19770.1
Sequence
MALEYTSRASKRRITALCSEANLPEEIMSEILLLLPARSVLRCRAVCRSWAALLCSRGFL
DAYAVKADTRSRRMDKFVLFAPSAALPNRSTAVYSFARGAVGAPLFTVDRVRADFLCLSS
RPCHGVMLFSDTRSGTYWVCNPSTGERSPLPKQHRGLTESSAGLVYEDRTKECKVVHLFK
DARMIGCEIYTLCDPSRQWRPANQDVGLLGTENMVVKLMNALQTEDLVTKAPPVFANGCL
HWLLYPNSMDMQAEPAGRDALLCFSVATETFTLLNAPASVLVAEYRELDDSFPAVPVHLA
ELEGYLCLVHDLRRRGQGRNCWLDVWMLRDHGASEWSLDYRIALHTHDVHIPRFITVLGC
CSGVGQEGNFRETRKKLLIASSQHQVHTYDPDTGDVQLVVSVPDTDIRIGQKEAPAALWF
GLYEDSLVRIGSESHQEKQELSALTEILVRLPVKSIAQSMLVCRRWCSLIESESFVAAHM
SVKRPKRILMANNGRARRALFDFAPVKNWLQAAGPAIAKDKIICSKPCNGLSLISTGNDD
FLCNVCTGAIQCLGRRGKSHFSPTGNHRRHAFSVGRNIGFGFDRSTGEHVAAEIGHISGT
LACMIKTSSEKQWSCVGKPPRPVSDMPPAHVDGTIYWMSKPMHEEARAVVAFEISTRAFR
VLPCEPCLNNDHDDAFVVELTAGTLSVVVVNAEAEEMDIWVMHKHSSSWVYAYKIQLGQH
ADYSLRRGQVVVPMDEEDGNDGRILLNTGRALGYYDTKTGALDHLYSLDKLKLPRSNLAF
PILCQESLIRIQDDELPSRVAHPVRDQGCKRCDHPEHADASPAGRGRALLLPCEGGACRD
IGVVYRSCCRRLFCGACQRRCLEHSQTHALRGDPVLPAYGFDATMVSPDSVLPFCHPSVP
GPEYCYYNSIEDGDVVRHVFISLKDYMRGEQSCRWTECGYRMEGQVVKEIWVRRYLKL
Download sequence
Identical sequences I1J138
15368.BRADI5G19770.1 EG:BRADI5G19770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]