SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G25930.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G25930.1
Domain Number 1 Region: 68-267
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.61e-18
Family WD40-repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G25930.1
Domain Number - Region: 874-912
Classification Level Classification E-value
Superfamily RING/U-box 0.000257
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G25930.1   Gene: BRADI5G25930   Transcript: BRADI5G25930.1
Sequence length 951
Comment pep:novel chromosome:Brachy1.0:5:27067071:27074162:-1 gene:BRADI5G25930 transcript:BRADI5G25930.1
Sequence
MSSARRGGHQHHNPLENGDGGEHEREEDDDEEDGEEEVGEDEEEEEEPRLKYQRLGGSVP
AILSTDAAAAIAVTDRAVLLGTHDGTLHVLDFQGNQVKQIAAHTATINDISFADGEYIGS
CSDDGTVVISSLFTDDKLKFEYHRPMKAIALDPDYSRNYKRFATGGLAGQVLVQTKKTWG
GGYSKKVLRDGEGPIHSMKWRSDLLAWANDAGVKVHDMKMERGIAFIERPKGIPRSDFLV
PHLVWQDDAVLVIGWGTSVKIAAIRTDLSPGYNGIQRSITTASSGKYVDIVGSFQTGYHI
SGIAPFGDLLVVLAYIPEEDSRDKKDNTSVPSRQGTAQRPEIHLVSWKNEELTTDALPIH
GYELYKAKDYILAHAPFSGSSNAGGQWAAGDEPLYYIVSPKDIVVAKPRDTEDHIAWLLQ
HGWHAKALAAVEAGQGRTELLDEVGSRYLDHLIIERKYAEAAQLCPKLLRGSPSAWERWV
FHFAHLRQLPVLIPYIPTENPQLSDTAYEVALVALTTNSSFHELLLTTIRNWPPTLYSAS
PVISAIEPQLNSSSMTEALKEALAELYVINKQYEKGLSLFAELLKPEVFEFIEKHNLHDA
FHDKIVNLMILDSKRTVHLMIQHRDIIPPYEVVDQLLHASKSCDKKYLLHQYLHALFETD
IHAGKDFHDMQVELYADYEPRMLLPFLRTSQHYRLDKAYEIFAQKELVREQVFVLGRMGN
AKQALSTIINKLEDIQEAVEFVTEQHDDELWEELITQCLQKPEMVGMLLEHTVGNLDPLY
IVSLVPDGLEIPKLRDRLVKIVTDYRTETSLRNGCNDILKADCVNLLVKYYHEARRGVCM
ASLDEEVGTRIDEGSSRTGDRSSSLRTLEIKSRTRCGARCCLCFDPLSIQDISAIVFYCC
HAYHLSCLEGGLDSMKANNNARDSDEGSEDDDGSPSGESRMRCVLCTTAAA
Download sequence
Identical sequences I1J3A3
15368.BRADI5G25930.1 EG:BRADI5G25930.1 XP_003580810.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]