SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G26390.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G26390.1
Domain Number 1 Region: 207-302
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000334
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 2 Region: 53-122
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.0000709
Family N-acetyl-l-glutamate kinase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G26390.1   Gene: BRADI5G26390   Transcript: BRADI5G26390.1
Sequence length 306
Comment pep:novel chromosome:Brachy1.0:5:27414639:27418972:-1 gene:BRADI5G26390 transcript:BRADI5G26390.1
Sequence
MARAPAVAKPMLEHDTTGARFTRVYNSPGYGLCIYILDLLCTYEEYENVTTMRLCFLVSE
KLQPDQLPGHYSGPPSAPQSKVIHTCITEKSHVGRDGMQTKVASAVTAASKGVPAVIVRS
SYDNIRPYKVDKAPRISNGKNVVKAELVFRRGIAIFSPPPCLSSSSASGSYGYWYLTHFD
WNCVYGKISTMQEYQVRHLECLIGTKSPQFRYYVCTMNKPFVSPRQRMYLDHTEYLLPYL
DPAVNHLRIKLAGTSIAHRVHLMKGTDGRATITTNWQNFVHDAGLQEGDIVAFVFSARRT
KLCLHV
Download sequence
Identical sequences I1J3F7
15368.BRADI5G26390.1 EG:BRADI5G26390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]