SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G26867.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G26867.1
Domain Number 1 Region: 219-606
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.85e-93
Family Regulator of chromosome condensation RCC1 0.00082
Further Details:      
 
Domain Number 2 Region: 6-116
Classification Level Classification E-value
Superfamily PH domain-like 8.56e-24
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 605-680
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.01e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G26867.1   Gene: BRADI5G26867   Transcript: BRADI5G26867.1
Sequence length 1068
Comment pep:novel chromosome:Brachy1.0:5:27749415:27755529:-1 gene:BRADI5G26867 transcript:BRADI5G26867.1
Sequence
MADPVDIDKALIALKKGTQLLKYGRKGKPKFTPFRLSNDESTLIWISDNTEKSLKLASVS
RVLSGQRTLVFQRFLLPEKDHLSFSLIYNDGKRSLDLICKDKVETQVWFTCLNALISPGQ
HGSQPQYTDGMRTGALSFDCGRESSLSSSSTYTTDSLENKLSSANSTKDRSSGEYTYSER
TDASEMQVKSASSSDIRVSVSSALSTSSHGSGEDSESFGDVYVWGEVMCDTTSRSGSDGN
VHGPGATTDILVPKPLESNVMLDVSYVACGVKHAALITRQAEVFTWGEECSGRLGHGAGT
SIFQPRLLESLSICNVEIIACGEFHTCAVTATGDLYTWGDGTHNAGLLGHGSTVSHWIPK
RVSGPLEGLQVSTVSCGTWHTALITSSGQLYTFGDGTFGALGHGNRETISYPKEVESLKG
LRTISVSCGVWHSAAVVEVIMTQSNASSGKLFTWGDGDKYRLGHGDRSAKLKPTCVPSLI
DYNFHKSACGHTLTIGLTTSGHMFTVGSSVYGQLGNPNNDGRYPRLVEDKVGGGGVVEVA
CGSYHVAVLTNTGEVYTWGKGANGRLGHGDIADRKVPTLVEALRDRSVKRIACGSSFTAA
ISQHKWVSGVEQSQCSACRQPFGFTRKRHNCYNCGLVHCHSCSSKKALRAALSPNPGKPY
RVCDSCYMKLSKVLDSGVSYSRNTIPRIPGDTKAERMDTKATRVASATSSDMIKNLDVKA
AKQTKKSDHAPQFPAILQLKDIPFVGPGDLNNTGSTVSNGYSNDTRYAPQILRMPHLNSS
SSLSSESIESFREANELLKQEVQKLRAEVSSLRQEREQQDNELQKSEAKAHEAVTLAAEE
VSKSKAAKEVIKSLTAQVKEMAERLPPGEHDMKPPRVVYLPGGVVSPEIGGRESQKRYQP
GGIHYSQTPTYVASARVNGLPPQVHQTSNPGDNAMVPHESMFENFNKSKDFPAAAAQQRT
NGGYRPRSEDFDRRETERFQINLQGWNTRGSGSPSNQVEAEWIEQYEPGVYLTLVSLHDG
TKELKRVRFSRRRFGEHQAESWWSENHEKVYDKYNVRRTDRISSVMTS
Download sequence
Identical sequences I1J3L4
XP_003580861.1.954 EG:BRADI5G26867.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]