SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20009647m|PACid:23126045 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20009647m|PACid:23126045
Domain Number 1 Region: 157-398
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.08e-54
Family PP-loop ATPase 0.0003
Further Details:      
 
Domain Number 2 Region: 455-481,518-554
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000837
Family MesJ substrate recognition domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20009647m|PACid:23126045
Sequence length 603
Sequence
MQAFTLFHVRSGQVTCRKNTIKHENIWSHNTTFARAYFCPQLCRRNNDLKAVDSRSRDVI
PDSSQLCDREWASKITTNRAVDSPTCSLLDLKSAVSQTDTDGTLTAHKAQRASTWVHENV
RRAAPARTGYGKTARLGAGGRLWTSLHVKLQQSLTSSNLLGAAESVLVAVSGGQDSVCLL
HALVDLRPIWGWRLGVVHCDHGWRVDSAVNADFVRELAAQHLDLPCYVRAAPQGAVPSER
AAREWRYRVFADVAFAHGYDVVVTGHTATDRAETMLLNLLRGSGPDGLVALARSRPLGSY
SPADPTCAPGGELDIPRARSRSVRLVRPLLEFSRSQTQEFVEQLALPYFHDTTNDCNDLR
RNRLRNEVLPALRAGFNPRLDQALFRFLEVLDADLEYLTRVTEDLYDNVVSYEYRASSGD
HSSVPAQGSSDESGRICGGGGSGTATQQGISDSGSGGMLKLHELRRLPLAMQRRVVRKWL
ESAMDARARRGHRGCSEDGSQGGGEGRAGARAGNAPSRVRYEDVARCLALLHAPNRSNSD
SLCGGMVASVRDGHLVLWTPKAAAVEPGWSSSQQQRRQRRAGAAADPELACCTAEVSTAG
QGA
Download sequence
Identical sequences Vocar20009647m|PACid:23126045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]