SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20015304m|PACid:23132605 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20015304m|PACid:23132605
Domain Number 1 Region: 38-258
Classification Level Classification E-value
Superfamily Hsp33 domain 2.35e-57
Family Hsp33 domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 278-326
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.000000000017
Family HSP33 redox switch-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Vocar20015304m|PACid:23132605
Sequence length 342
Sequence
MLRRSAACTTRRNAVFGHGRAPRRCRFVVVAALRDDVLLRSLSTNAEVSVLVVDGTKLVS
EAQVRHKLAPTATAALGRSLLGALLMGSFRKEDEQVQITFQGDGEAGSILAIADTRGNVK
GKVNNPAADPPLRPDGKLNVGAAVGKGVLAVVRSHPLEPQPYTGMVPIVSGEVAEDLANY
LVDSEQTNSALGLGVSLDRDCRVKSAGGWLVQILPFCSEETLAQLEQNLTTMPTITTMLN
DGMSVQDITARILDGLGVLPDGQTVMPKYGPCEEEALKKRMIRAVAALGKQEVADIIKQE
GKLEVTCDLCQQTYQFSQQEIDNYIDGNEELQEVEHETTVQA
Download sequence
Identical sequences D8U253
jgi|Volca1|62890|e_gw1.31.99.1 XP_002952668.1.37214 Vocar20015304m|PACid:23132605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]