SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20000149m|PACid:23138477 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20000149m|PACid:23138477
Domain Number 1 Region: 8-252
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.79e-34
Family ADP-ribosylglycohydrolase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Vocar20000149m|PACid:23138477
Sequence length 312
Sequence
MVSLATPRQITDDSELAMALAMGLSQHEPSAGYPAEAVAKQYGAWLASHPFDVGNTCCTA
FSAATHHDDKAGPLASVMRKQAQFSRDSKSNGALMRITPLAVWGCRLSDDALAAAAMEDA
KLSHPNDVTLHANAIYCVAIKHLIAHPGDAEGALEVAAKWARACACAEVAGWLREAMGSA
AGPAANRLIGFVRYGFFYAFRHLKLRTPYLDAIREVLLLKGDTDTNAAIVGGLVGALHGA
SGIPAHMAAALLSRLGQADSKGPKRPDWLQPGRMPSLFAELYSKATGDTVDPSALPGVMA
ASAAGAAARAPC
Download sequence
Identical sequences D8TSQ0
XP_002949506.1.37214 Vocar20000149m|PACid:23138477 jgi|Volca1|89811|fgenesh4_pg.C_scaffold_14000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]