SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20000688m|PACid:23132626 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20000688m|PACid:23132626
Domain Number 1 Region: 4-44
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000732
Family Pollen allergen PHL P 1 N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Vocar20000688m|PACid:23132626
Sequence length 250
Sequence
MVTGRCCGDMAHFDLSIWGFERLADTKWGVIGVQYRQVPCSYQPAKQAPAAQNPTPGEQP
PSGGNSNVVRDWPEFDSRTALTVFNGGNGNNWYDASYNVQPGSYMTGMISGSAKCASTQP
KGAIVFKSSVQGNFADHVAVGLYIYMSTQNAIDKGVVLAIGGNQGDCAVVDLSEVKATGF
KPRCTQCVDYWWKWEVYFSAFAGFGPTSIINNAKYFKGCGGNTVQDLNYIEIRNYRNSAE
NLCVDNVRLE
Download sequence
Identical sequences D8TUJ8
Vocar20000688m|PACid:23132626 XP_002950168.1.37214 jgi|Volca1|90501|fgenesh4_pg.C_scaffold_17000062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]