SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20002416m|PACid:23131047 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20002416m|PACid:23131047
Domain Number 1 Region: 205-493
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.44e-96
Family Cryptochrome/photolyase FAD-binding domain 0.00000819
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 7.06e-43
Family Cryptochrome/photolyase, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Vocar20002416m|PACid:23131047
Sequence length 629
Sequence
MAGPKNSILWFRKGLRLHDNPALLEACRGAAHVYPVFILDPFFLQQSSYKVGVNRYNFLL
ESLRDLDASFRSRGSRLLVLRGKPEEVFPRVFREWRITQLCFEVDTEPYARVRDARIQGL
ADEAGVAVWTAVSHTLYVGLFCSCTAGRHGPVLGGCWLWKEKAPAPGGRRGPACPEGFEA
RHAHHLLFLVIYCNPTLLSFPAPPQAPTTIFKGGETEALKRLSASLADSKWVADFKKPDT
DPAAFERPATTVLSPYVKFGCLSPRLFHARLLEVYRRHRGHSQPPVSLRGQLLWREFFYT
VGAHTPNFHRMDGNPLCKQIDWDDDEELLAAWREARTGFPWIDAIMTQLRQWGWMHHLAR
HSVACFLTRGDLYVSWERGMQVFEELLIDQDHYLNAANWMWLSASAFFSQYFRVYSPISF
GKKYDPEGKFIRKFLPVLKDMPSKYIYEPWTAPSEVQRRAGCVIGRDYPHPVVDHALVSK
QNIARMAAAYRSNKAAGGDGDGDGDDNGDEGVVTAAKAKAKAKAKGNPGGKSPKKAAATA
TATAAAAAATAKRKGAKSSGAATAGAAATATPTATATPTATATDAVKAVSSGPRGGKRQR
TISETLTHAATTATATAGGTAGPSSSKAT
Download sequence
Identical sequences Vocar20002416m|PACid:23131047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]