SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20002975m|PACid:23131051 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20002975m|PACid:23131051
Domain Number 1 Region: 13-242,270-350
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.44e-28
Family ADP-ribosylglycohydrolase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20002975m|PACid:23131051
Sequence length 352
Sequence
MAAPATTMADKANVKERAKAAILGGLLADAASMPLHWIYDVPKIQDLLASKSREATPEFF
PEPSCPFYKHPYGSLSPYGHELIPLLRSMAENGGELDENKYGEAMYGYFTAEEPDAYRNR
SVRSIVAGWEEGKRGKELGDKDDFQANCFAKASLLVARYAGKPELREKMEAAVRVQQNND
QAVAYGMAGALLLEKVVLGQSVSEALSWAVGEGGLQPDMGALVERALATRTQPLRELTYE
PVPYMVEMVSKHMALRDSLSPFALAVWCNGPACGNPAAFTNVAMAAAQYGNSYVDAVRAN
MLAGGDNCSRSLLIGALLAAEGGMSCLPREWTSQVPKWAQYEELVDRLLAAP
Download sequence
Identical sequences Vocar20002975m|PACid:23131051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]