SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20008390m|PACid:23125241 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20008390m|PACid:23125241
Domain Number 1 Region: 28-58,100-222
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 9.77e-28
Family Eng V-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20008390m|PACid:23125241
Sequence length 382
Sequence
MELLLAIALGAALFGGFGSPASAGYDWQWHTGRATHYGGPGDPWSIHNGHCAYGYLDPNV
EARKSSSGPDELGGSWTARPSEKFSNKFDNSVSVALRLSSVRTGWDICAPSDQNWDYDAA
TSNCGLCYEVACQGMDFNDFYGNSLERQSVCYDSSASVILMVTDLCPCYYPANQYSNKRW
CCGDMQHFDISSYAFQKLADMKWGVIGVKYRRVPCDYQPANRAQLPSFMQGWSDSGSWSI
SRWGRDSSWGFDGQQAYCVTMGGYAGIQFNGWSGVFSSKRTLEFYARQNNGGTPDVSIKL
TAPSGGCKALQLRDMTPKDQTSNWSRFQVQLSAFDWRQSGGGDGSAFGGCSDSINDWSVN
VLVIMNNWGGNQDLCIDQVKVY
Download sequence
Identical sequences D8TZV1
XP_002951976.1.37214 jgi|Volca1|105296|estExt_fgenesh4_pg.C_260114 Vocar20008390m|PACid:23125241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]