SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20010916m|PACid:23129130 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20010916m|PACid:23129130
Domain Number 1 Region: 25-141
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 6.63e-20
Family Pollen allergen PHL P 1 N-terminal domain 0.032
Further Details:      
 
Weak hits

Sequence:  Vocar20010916m|PACid:23129130
Domain Number - Region: 560-618
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0269
Family Myb/SANT domain 0.032
Further Details:      
 
Domain Number - Region: 297-386
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0283
Family D-glucarate dehydratase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Vocar20010916m|PACid:23129130
Sequence length 1617
Sequence
MMGKIKLETSSLSISLLFIVGLGLCSANNGWTTGRATWFDVGPDMSKKCFEVRCRNADFA
DGNGQSLSRSNACYDENKSVVITIVDACPCNYPNNAHSNRRWCCGDMNHLDISQEAFQQL
ADVNVGVIGLSYREVDCHHQSDSNASADRTNINAMSATADQKPKEDALLEKATVLKAQWK
SLAAAFNFPCEEPKRQATHWDYLLREAQWLAEDFMQERLWKQAAAMRIAHDAASFDRTKL
KHVQTKVTLECAPEELGRVKGSLAEAVDGRSRKLPNGGTESGPTAPSTPDREAELPGLPL
CDHLTFGVLVSAEELMEAVVRQLEVGLRVGRVWVWGAAGGQCKGLRGWFAEEDVARLTAY
AELVSDYKAAYDAAQYARSSSALSDAEDMPIGRKFPLGGIRKGTGARPKLALPSGADDTD
SLGEASPAPTHHRVGGVAGGAAARRIGPGGAAAHRAAAAAADDDVHPSKRKRKQIRDFED
DDAVVAPGPANKGLKLKTAAGLKDDRSKKLKSPAKPPGGAHAVGGFGAGREGPGAHAGAP
KGSAVGPLKHPLLRGTANIPDGGMRGLPWSGTDDQVLAAIVTEFTQNWLLVADVMRSANN
MLGVYRRPEICKYRYAMLVKAWQQENGEEGAPETQHNALSLAIMPKQQAKEVLYQVLPVS
EATLRRHQEAVANLHVRFRTKRHGERQQQREMYRTRHEQHTSHYIVSQNVLQANGGRILN
PLELGLGPSIPDPAAVAAAAAAAMQGGSGATQGGPGLGSQPQPSHLQGQSSMGPGMQQPP
QAQQQPSQQQQSLAQPPPQPQQQQQPGMSDAAQAAAGGLQSQQSGPGMPGTLPPGMGQAH
TGGIQGMQQQGQQQMQPGVMHPGAMHPAQLAAIQQQQQQQQQQQQQQQAAAMTPNAVSAQ
AAVAAMAQQNARLQTAMQAMQQQQQQVAMQQQQQQAMQQQQQQQAAMQQQQQQQQAQQQH
AAAATAAAAAAAQGQQAAGQQGLSMAPGAPPGVPAPGQPQPNAAQMAAAAAALQQQHQQG
RVPTPPLQSMPSLPGMQPVRAPNPAMLANQQALLQSQMMKQKMMQQQAQAQAAAQQQQQQ
QLGLATGAPAGVTGQQPTPQQLVAAAAAQQQQQQQIAAAMQQQQQAMQQQQAMQQQQQAM
QQQQAMQQQQQAMQQQQQQQHAANAVQLQQQVAAQQQQQQAAAVAAVAAQQQQQQAAAAA
AAAAAAAGQQGQQGQPQQGQLPPGQQAIQPGAANGAQQALQSGNLQTQLQPGMLQSQQPG
LGNAAAAAAAAAAAAAQLNKPPTPNPMAGSAGAAGAATQGNAATAAAAAAAAAAAIQRPP
AHPTQLQMQALAGRLPGMLGAIPGGLPGTAAMNTVALAAQMQKAGLQPGVMQNAASLQAL
QQKMQQQMQAAGAAAAAGGAGRPPMMPGGLPAPGTPGLTSGGLAGQPGALPGQLTPGQQP
GLQGQQQQAALAQFQAQQQAAAAAAAAAAAVGGAQGQAGAGGLPPGQGPPGSLAPSTLPP
NMAAFINQNPGALLSMAARPGLPQMPAALQQQLSMQPGPQPGGLQPNLQQQQQQQVAIHA
VAAAAAAAAAQQQQQQQMQLSGGGLLQPGMVQSGMVQGPPGVQQQQQAAAAPQPTAG
Download sequence
Identical sequences Vocar20010916m|PACid:23129130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]