SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20012570m|PACid:23129738 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20012570m|PACid:23129738
Domain Number 1 Region: 212-487
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.92e-94
Family Cryptochrome/photolyase FAD-binding domain 0.0000000553
Further Details:      
 
Domain Number 2 Region: 15-201
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 6.02e-50
Family Cryptochrome/photolyase, N-terminal domain 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Vocar20012570m|PACid:23129738
Sequence length 914
Sequence
MEPVERHPANYEFQTAVVWFRRDLRVDDNPALEAALNAAATVIPVFIWAPEEEGQFQPGR
CSRWWTKHSLVDLQQALAALGSRLIIRRSTDSTAELLKVVGEVRAEAVFFNHLYDPISLM
RDHDCKRGLAAAGVAHRTFNGDMLYEPWEVLDVNKQPYSTFDDFWNSVRAMTVPPPFPMA
APAAMPPVPAFVPSLMVSEVDWFFTAEQEASSDQLKFKWKPGVGGAIAELERFVTERLHV
FEHDRAKVDRDSTSRLSPWIHIGSISVRYIFYRIRQCQAEWLAAGVDRTRSCDDFLQQVG
YREYSRYLSFHFPFIHERSLLRHLRACPWRIDQHAFKAWRQGQTGYPIVDAAMRQLWSSG
WCHNRARVVAASFLVKNLLLPWQWGLKHYWDAQIDADLECDALGWQYVSGGMSDAHPFSY
MMDLEKEARRFDPDGEYVRRWLPVLSRLPTEYIHGPWKAPPQVLAAADVELGCNYPAPII
SHNDARVNVEYACSVLDKCVVAQSSESSGRYPYRAPTYPAAMGGAGASSGANPTGTGGGG
GTYGGSAPGSRQNPHMYGSASGLAPEQAQAGSGSRGGGWVSGGGSAGMREDGGGVSGQRV
RRDAPSGSAGGGSGGGGGAPGSAPVSQLAAGGMPPPQALAPAPGGGVYYHPGDAAGQQVL
EQILQQQRRTRAATVRQQDGSGTDRPPPHYQNQIQQMPPPPPQQQHFQQHNAGQGMPPDG
GADTTLAAAAAAAAAAAAAAAAWAGRVEAGDADEEAVALWQQQQMLQGGTAAYAFEQAMQ
MLLARRRMGDGVSAISGDQGGDQGPDGPDLDDANSEEVVSNTVNLNMTAFTGASAYRNQA
GTARGARKRGREAAAAAAAAAKAGGRDDGAGHEEEVEEGQVGRFSPPLDILHLVMMCSFS
SKISLTEFFCHFTS
Download sequence
Identical sequences D8UF46
Vocar20012570m|PACid:23129738 XP_002957272.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]