SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20012914m|PACid:23129705 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20012914m|PACid:23129705
Domain Number 1 Region: 2689-2855
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000654
Family Tropomyosin 0.0043
Further Details:      
 
Domain Number 2 Region: 2873-3045
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000118
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Vocar20012914m|PACid:23129705
Sequence length 3165
Sequence
MDTSDDLTSLRFGGGEKPAVPLGADELVAYYEKQLAATQLVQHRLQKQCNLLAEEKLALE
TSLSAQTAALQQQLVFAREKAECALAEAEHAQQQVQEARDAVGDIVGAVTHLAELLDISG
ATEELTHSFEAVAHSTQRTFKAVAAAQERSQAVLEVQLEARDACFVSPLLTAASVVSPQG
TDATKRMEEDTVRLRKDLDDAKKREQELEAEMRAAQVLFSALESEVVNLQHDQAQAAAKL
QLSQEELVAARDELRMAHKALLAARSPAASALTQGLAKLDAHLVSVHSFLEGLSMPQPTP
LADALGSTLQLHASRSYDGTTARRPDTFDDGRNSAESGAFPRQQGASTYQQLCALVATAS
GEGPAQALLQGVARKTRLRHQGAEQADMSALTQVPEAPDEGQGAARNHMQRSREDLSQRM
ATLAAERDHLRNRALELESRVTSLETEKEGLLRDRTRQLGMAAAAGAAGAAVAVVVATDA
SSTAPSSPSRPFRVAAPASIVGSESSFTAIAARDAALRRSESLEVEALRDLLRQGAEERG
GAQRLLERLMAVRPVASKQLQYRKPARLARLQTTASSAACSGAADLAVGQYPDVPLVASP
HSPLSRPSPGQTRSRRSYSSIASDSQSVDEAEDVFSGQCEPFHEVSRVYTRSSTALQSSY
ASFASEAPLAPTRRYTEDSQPHTYPLHPTEPLEGLLPAAATRSLLSSGDGGLLREGSRGP
RRSYRTSRAGSDVQSLMAEVDQLQAALCSVLISKAVACTELQAESEQSLAALRAAHDVEL
AKLRGKHSVEVSQLQALLSMSADMSPTPVSQHAAVRSLDKSTCVSEDGLLGGHFGAGMLQ
HTASLDVMMLEIEEHSQQLAPRSKESLQRLKNDHAPQEWESCRQQAWSNQAVGDLTNHEW
AARQKLLDHLQLQCTQHEACIIELREQHAADLMDQQARHSERCLQLQADAVAETAQPTSG
HPDEKCPLVVYEEQLAELRLVVRRLEELRTAERKLADADLIALQEMMAELREKQLSELRE
KVAEKLAEHKVACAALETSQEEVSSERAAAEQLRHKLGACEKELQLRASLISDLQGQLQQ
LQSDKELEEQSLQSLLSTKTWMTEEIRSLQAELKETSSKLAVAEADLAAMKVAKNDRASS
SAGWRLDAATAPSWHRTRDVHATTDALGHGPGGATMASPSRGMGEAQVGSVITMAADQLA
EVAMQAALAEAQFENLHLLQKADVPSDHAVRQPLYKDDVEKTNLMIETVSLQGELDQLQG
KYRTLQAQLEAAADELACAVMRASLAELQRDQLRLERSGAMRSTGAASSRPKQPGRADDT
RFACPPTGVDAAISHGTFTPSKPTDMLLVIDAPDLLGTDAFIPVQQVRQLYRELRTVRRA
LSDVMDTDAVMQCPATSGDEQIAKNAQDGALATGFVHAEIARAHDVYHDTCKVYEMLRSD
AEDINSQLWRWNVQLHKQLCSKENDLTREQQKAIPGPQHAFESLLSRKEAYARSVEGQLS
ELQAALQAAQSRLLHRDGQVAALEHMLVQLSEQITMFEDVVVRCEEVPSVESFDGDVEGA
IEKLKNLICALRSQLKRYRGGHAVSRAAMPAFSSLLAARSQALQTPAATGGLSTVQVALI
AAEREVLSLRSQLSHRQQHIKLLEQRLLEQSQDIAAMCNRGDTLTASPVGSRKASFVERR
FGHGTEVLQPQKAWDFDGLDISGTSGNLADQMRPQLRVQIEEYRTVLAIVAGGQYEQDQN
RLGGAQQRAGEAGGPCRADGSSFSGAGPASPAGGPSSPSLGNARYKEMKRQLDEAAHMLE
GSQDQLLAMQEDADAKEASLQRLNEQLQAMGSSETGRFSASSAAMGDGQTSLPLGHGAST
TVHRNLLFDEEALPGNNQVKELEEIRTERDSAMEQLPLLKRAKRELEARVKELTAEVKLK
DEQLEELQIARQRLDDSTHELNVIAEALEANTQRLAEARAVAGAAGADLEVERRARQQLE
RQIAGSLVAAAKSSPAAEQHHMGRGLASPKGVSSRASSPTRSRAGSPVGSSALATSSGGA
SSVGTHHMSVSQGVDRQADGQVQILSREVTDLLLQLRNAIVANTQAQSNLYEQVQSHSLG
QPVGSPGAGPHLRDPLAALAEAQERVKALSDASVQAREELCAVSAARDAALAHAAELLAK
NQQAQAEVERLSVACVEARTQETGLKRRLANVNEEAELKLVTLEAAKEQLLGQLRKADER
AHTLQVQIEEKASALLTLSLAHAGDQVKITSLEASLAAARSINNSLWSQLEAVANKVGMD
TYPAAPGSLKGRWSYSGLPSTAAAHSSSESHVGNMARTLGTVTRSPDLQEVPSEACQVHR
GLQLLQPEYATEDDSSAPVIPSDEVASPYKRSETDDGVRFTAVPDVATAVQSYMDSLHLD
ASAVRTQLEAELREARGQIAAALQEVAELGARGASLQVHDRPHVESDGHRVEGRHNLYSS
NEIAGTAIPCGLQAPQPEAERSINMADVRILTAAKAALQQQYEDAEAGRAMAEQQLAQAL
NEIRELQRRVSAAKEMPVLMHQEMAEIKASHDEQQFEEAETRRMAVQAELDEADRDYPAG
LVALEVANSAQRQHDKDSPAGRVMVEQLLAEAVNEIAELKRRVAVGEAPAQHQIAEVETS
RAKFQKQFEEAEMGRMSLLAELDEARRDLSAAVAGREAKEALQRQYDDAVASRALAEQQL
LDARAEIEELERRVTAADEKEALVLRRVQDVETSRAELQQQLRGAEASRSALQAELDEAW
RAHSTALAGLEGAKEALKRQFHDAVASRGTAEQQLAEARAKIDELESRVSAAEEKEALMQ
RQVEATETSRGKLQQQLEDSEARRVSLHAKLADADRAYSAGMADLEVSSAANRQQSENAD
ASRVIAEQRLAEACTKVEELQRRVSAAGEKEALVQCRVQEMETSRAELQQQLRGAEASCK
ALQAELDEAWRAHSTALAGLEGAKEALKRQYEDAVASRVMAEQQLAEARAEIEELECRVS
AVEETVVLSQQRAGAIEASRAELQQQLEEKETSRNALQIELDKALLVHSTAVADMEAAKK
ALQQQLEDAEAGRVMAEQQLAEARAIIVDLQKRVSAAQEAASSAQQQLGEVEASRSAAQQ
QLLGLQLQLSAKEVELKGLIERIGALNQQISSICSLVEGYHCIDA
Download sequence
Identical sequences Vocar20012914m|PACid:23129705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]