SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20014166m|PACid:23134312 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20014166m|PACid:23134312
Domain Number 1 Region: 58-308
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 7.19e-28
Family ADP-ribosylglycohydrolase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20014166m|PACid:23134312
Sequence length 321
Sequence
MSSLSMFKDTKNNTYNGKQVPGSVNFHPKHIVTLAPCPNNGDVINHGKHAFWGKPGVHYH
QGMKAGENTLNAICARLVLRNLAKEKGYSTSSWLQDYVTFMTTPGSHNDTYAESFHRDFF
RNWAAGVPPERCSQGTEGHNTAQIGGFVMLPPVILSRLDGPEAATQRALQHLTTTHESRK
LAAYAQKYSDLVYGLATGGDLRQATSALAKGMGIDLAQLVPYDDIRIVHSTFGSACYIED
SFPSLLYLAYKYADSFEKAVLANTNVGGENCHRGAALGAVMGAAHGESGIPSRLIEGLAE
AATIRQEIDAYVQALHPELLV
Download sequence
Identical sequences D8TLD4
Vocar20014166m|PACid:23134312 XP_002947265.1.37214 jgi|Volca1|103347|estExt_fgenesh4_pg.C_50192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]