SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386729900|ref|YP_006196283.1| from Staphylococcus aureus subsp. aureus 71193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386729900|ref|YP_006196283.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 6.28e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386729900|ref|YP_006196283.1|
Sequence length 104
Comment PTS system lactose-specific transporter subunit IIA [Staphylococcus aureus subsp. aureus 71193]
Sequence
MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSL
LAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRGL
Download sequence
Identical sequences A0A0E0VR38 A0A2A3KFT5
gi|387603482|ref|YP_005735003.1| WP_001078310.1.100265 WP_001078310.1.100272 WP_001078310.1.100347 WP_001078310.1.100452 WP_001078310.1.10053 WP_001078310.1.100534 WP_001078310.1.100678 WP_001078310.1.100726 WP_001078310.1.101055 WP_001078310.1.101142 WP_001078310.1.101217 WP_001078310.1.101352 WP_001078310.1.101495 WP_001078310.1.101531 WP_001078310.1.101670 WP_001078310.1.101821 WP_001078310.1.101999 WP_001078310.1.102084 WP_001078310.1.10209 WP_001078310.1.102126 WP_001078310.1.10308 WP_001078310.1.10358 WP_001078310.1.10469 WP_001078310.1.1060 WP_001078310.1.10617 WP_001078310.1.10785 WP_001078310.1.10843 WP_001078310.1.11188 WP_001078310.1.11223 WP_001078310.1.1124 WP_001078310.1.11281 WP_001078310.1.11475 WP_001078310.1.11660 WP_001078310.1.11741 WP_001078310.1.11781 WP_001078310.1.11919 WP_001078310.1.12137 WP_001078310.1.12605 WP_001078310.1.12705 WP_001078310.1.12707 WP_001078310.1.12802 WP_001078310.1.12951 WP_001078310.1.13112 WP_001078310.1.13170 WP_001078310.1.13366 WP_001078310.1.13376 WP_001078310.1.13728 WP_001078310.1.13769 WP_001078310.1.13870 WP_001078310.1.13884 WP_001078310.1.13948 WP_001078310.1.1418 WP_001078310.1.14298 WP_001078310.1.14337 WP_001078310.1.14349 WP_001078310.1.14363 WP_001078310.1.14665 WP_001078310.1.14681 WP_001078310.1.14747 WP_001078310.1.14770 WP_001078310.1.15071 WP_001078310.1.15150 WP_001078310.1.15206 WP_001078310.1.15532 WP_001078310.1.15591 WP_001078310.1.15679 WP_001078310.1.15819 WP_001078310.1.15888 WP_001078310.1.15948 WP_001078310.1.16157 WP_001078310.1.16399 WP_001078310.1.16436 WP_001078310.1.16478 WP_001078310.1.17009 WP_001078310.1.17143 WP_001078310.1.17176 WP_001078310.1.17201 WP_001078310.1.17569 WP_001078310.1.17928 WP_001078310.1.17974 WP_001078310.1.18043 WP_001078310.1.18495 WP_001078310.1.18656 WP_001078310.1.18719 WP_001078310.1.18963 WP_001078310.1.19014 WP_001078310.1.19102 WP_001078310.1.19109 WP_001078310.1.1921 WP_001078310.1.19306 WP_001078310.1.19375 WP_001078310.1.19377 WP_001078310.1.1943 WP_001078310.1.1962 WP_001078310.1.19700 WP_001078310.1.19759 WP_001078310.1.19881 WP_001078310.1.20558 WP_001078310.1.20979 WP_001078310.1.21064 WP_001078310.1.21102 WP_001078310.1.21894 WP_001078310.1.21954 WP_001078310.1.22022 WP_001078310.1.22093 WP_001078310.1.2211 WP_001078310.1.22200 WP_001078310.1.22259 WP_001078310.1.22418 WP_001078310.1.22727 WP_001078310.1.22739 WP_001078310.1.22975 WP_001078310.1.23069 WP_001078310.1.23217 WP_001078310.1.23516 WP_001078310.1.23568 WP_001078310.1.2382 WP_001078310.1.23856 WP_001078310.1.23896 WP_001078310.1.2420 WP_001078310.1.24275 WP_001078310.1.24436 WP_001078310.1.24439 WP_001078310.1.25029 WP_001078310.1.2522 WP_001078310.1.257 WP_001078310.1.25776 WP_001078310.1.25852 WP_001078310.1.25984 WP_001078310.1.26033 WP_001078310.1.26172 WP_001078310.1.2619 WP_001078310.1.26289 WP_001078310.1.26397 WP_001078310.1.2645 WP_001078310.1.26584 WP_001078310.1.26749 WP_001078310.1.26850 WP_001078310.1.2687 WP_001078310.1.26929 WP_001078310.1.26963 WP_001078310.1.2697 WP_001078310.1.27080 WP_001078310.1.27168 WP_001078310.1.27467 WP_001078310.1.27696 WP_001078310.1.27799 WP_001078310.1.27929 WP_001078310.1.28079 WP_001078310.1.28447 WP_001078310.1.28482 WP_001078310.1.28564 WP_001078310.1.28584 WP_001078310.1.28614 WP_001078310.1.2862 WP_001078310.1.2891 WP_001078310.1.2913 WP_001078310.1.29244 WP_001078310.1.29301 WP_001078310.1.29731 WP_001078310.1.2983 WP_001078310.1.2997 WP_001078310.1.29982 WP_001078310.1.30130 WP_001078310.1.30191 WP_001078310.1.30385 WP_001078310.1.30566 WP_001078310.1.30568 WP_001078310.1.30648 WP_001078310.1.30650 WP_001078310.1.30652 WP_001078310.1.30880 WP_001078310.1.30907 WP_001078310.1.30928 WP_001078310.1.31041 WP_001078310.1.31065 WP_001078310.1.31077 WP_001078310.1.31113 WP_001078310.1.31278 WP_001078310.1.31441 WP_001078310.1.31497 WP_001078310.1.31568 WP_001078310.1.31589 WP_001078310.1.31605 WP_001078310.1.31743 WP_001078310.1.3188 WP_001078310.1.32077 WP_001078310.1.3231 WP_001078310.1.32599 WP_001078310.1.32761 WP_001078310.1.32763 WP_001078310.1.32829 WP_001078310.1.33029 WP_001078310.1.3330 WP_001078310.1.33328 WP_001078310.1.3343 WP_001078310.1.33538 WP_001078310.1.33567 WP_001078310.1.33607 WP_001078310.1.33655 WP_001078310.1.33707 WP_001078310.1.33767 WP_001078310.1.33850 WP_001078310.1.33989 WP_001078310.1.34060 WP_001078310.1.34078 WP_001078310.1.34254 WP_001078310.1.34427 WP_001078310.1.34473 WP_001078310.1.34733 WP_001078310.1.34774 WP_001078310.1.34912 WP_001078310.1.34943 WP_001078310.1.35054 WP_001078310.1.35182 WP_001078310.1.35194 WP_001078310.1.35423 WP_001078310.1.3549 WP_001078310.1.35506 WP_001078310.1.35730 WP_001078310.1.3574 WP_001078310.1.35742 WP_001078310.1.35958 WP_001078310.1.36041 WP_001078310.1.3611 WP_001078310.1.36698 WP_001078310.1.36754 WP_001078310.1.36797 WP_001078310.1.36916 WP_001078310.1.36962 WP_001078310.1.37045 WP_001078310.1.37091 WP_001078310.1.3718 WP_001078310.1.3719 WP_001078310.1.37453 WP_001078310.1.37866 WP_001078310.1.37875 WP_001078310.1.37891 WP_001078310.1.38020 WP_001078310.1.38034 WP_001078310.1.3813 WP_001078310.1.3817 WP_001078310.1.38557 WP_001078310.1.38786 WP_001078310.1.38943 WP_001078310.1.38979 WP_001078310.1.38985 WP_001078310.1.3908 WP_001078310.1.39285 WP_001078310.1.39378 WP_001078310.1.39519 WP_001078310.1.39613 WP_001078310.1.40383 WP_001078310.1.40401 WP_001078310.1.40554 WP_001078310.1.40748 WP_001078310.1.40800 WP_001078310.1.41011 WP_001078310.1.4102 WP_001078310.1.41058 WP_001078310.1.41104 WP_001078310.1.41122 WP_001078310.1.41133 WP_001078310.1.4144 WP_001078310.1.41473 WP_001078310.1.41532 WP_001078310.1.41533 WP_001078310.1.41817 WP_001078310.1.41891 WP_001078310.1.42001 WP_001078310.1.42460 WP_001078310.1.42738 WP_001078310.1.42740 WP_001078310.1.42819 WP_001078310.1.42848 WP_001078310.1.43020 WP_001078310.1.43114 WP_001078310.1.43200 WP_001078310.1.43206 WP_001078310.1.43506 WP_001078310.1.43988 WP_001078310.1.44186 WP_001078310.1.44331 WP_001078310.1.44536 WP_001078310.1.4499 WP_001078310.1.45008 WP_001078310.1.45114 WP_001078310.1.45221 WP_001078310.1.45878 WP_001078310.1.46013 WP_001078310.1.46109 WP_001078310.1.46965 WP_001078310.1.47276 WP_001078310.1.47719 WP_001078310.1.47989 WP_001078310.1.48425 WP_001078310.1.48775 WP_001078310.1.48818 WP_001078310.1.49154 WP_001078310.1.49173 WP_001078310.1.49234 WP_001078310.1.49330 WP_001078310.1.49704 WP_001078310.1.49715 WP_001078310.1.49913 WP_001078310.1.49936 WP_001078310.1.50015 WP_001078310.1.50229 WP_001078310.1.50360 WP_001078310.1.50431 WP_001078310.1.50516 WP_001078310.1.50669 WP_001078310.1.50759 WP_001078310.1.50827 WP_001078310.1.51008 WP_001078310.1.51062 WP_001078310.1.51085 WP_001078310.1.51138 WP_001078310.1.51787 WP_001078310.1.51812 WP_001078310.1.5190 WP_001078310.1.51920 WP_001078310.1.52162 WP_001078310.1.52252 WP_001078310.1.52259 WP_001078310.1.52536 WP_001078310.1.52772 WP_001078310.1.52820 WP_001078310.1.52838 WP_001078310.1.52904 WP_001078310.1.53007 WP_001078310.1.53077 WP_001078310.1.53661 WP_001078310.1.53682 WP_001078310.1.53712 WP_001078310.1.53714 WP_001078310.1.53763 WP_001078310.1.53786 WP_001078310.1.54135 WP_001078310.1.54269 WP_001078310.1.54477 WP_001078310.1.54847 WP_001078310.1.54914 WP_001078310.1.55090 WP_001078310.1.55352 WP_001078310.1.55620 WP_001078310.1.5565 WP_001078310.1.5575 WP_001078310.1.55839 WP_001078310.1.55848 WP_001078310.1.55859 WP_001078310.1.56099 WP_001078310.1.56210 WP_001078310.1.56213 WP_001078310.1.56241 WP_001078310.1.56260 WP_001078310.1.56272 WP_001078310.1.56275 WP_001078310.1.56364 WP_001078310.1.56522 WP_001078310.1.56525 WP_001078310.1.56679 WP_001078310.1.57158 WP_001078310.1.57271 WP_001078310.1.57291 WP_001078310.1.5735 WP_001078310.1.57385 WP_001078310.1.5743 WP_001078310.1.57612 WP_001078310.1.57635 WP_001078310.1.57928 WP_001078310.1.58139 WP_001078310.1.5827 WP_001078310.1.58584 WP_001078310.1.58588 WP_001078310.1.58860 WP_001078310.1.59178 WP_001078310.1.59334 WP_001078310.1.59414 WP_001078310.1.59594 WP_001078310.1.59864 WP_001078310.1.60118 WP_001078310.1.60158 WP_001078310.1.60339 WP_001078310.1.60355 WP_001078310.1.60719 WP_001078310.1.60730 WP_001078310.1.60742 WP_001078310.1.60859 WP_001078310.1.60934 WP_001078310.1.61019 WP_001078310.1.61318 WP_001078310.1.61346 WP_001078310.1.6149 WP_001078310.1.61515 WP_001078310.1.61653 WP_001078310.1.61709 WP_001078310.1.61713 WP_001078310.1.61776 WP_001078310.1.61843 WP_001078310.1.6188 WP_001078310.1.61962 WP_001078310.1.61976 WP_001078310.1.62127 WP_001078310.1.62392 WP_001078310.1.62462 WP_001078310.1.62563 WP_001078310.1.6266 WP_001078310.1.62925 WP_001078310.1.63021 WP_001078310.1.63107 WP_001078310.1.63255 WP_001078310.1.63288 WP_001078310.1.63540 WP_001078310.1.6355 WP_001078310.1.63672 WP_001078310.1.63704 WP_001078310.1.63763 WP_001078310.1.63890 WP_001078310.1.63998 WP_001078310.1.64060 WP_001078310.1.64181 WP_001078310.1.64232 WP_001078310.1.64408 WP_001078310.1.64434 WP_001078310.1.64446 WP_001078310.1.645 WP_001078310.1.6453 WP_001078310.1.64537 WP_001078310.1.64911 WP_001078310.1.6509 WP_001078310.1.65164 WP_001078310.1.65274 WP_001078310.1.65599 WP_001078310.1.65704 WP_001078310.1.6578 WP_001078310.1.65928 WP_001078310.1.65990 WP_001078310.1.66014 WP_001078310.1.66227 WP_001078310.1.66328 WP_001078310.1.66518 WP_001078310.1.66645 WP_001078310.1.6668 WP_001078310.1.66690 WP_001078310.1.66792 WP_001078310.1.66853 WP_001078310.1.66906 WP_001078310.1.67016 WP_001078310.1.67152 WP_001078310.1.67375 WP_001078310.1.67620 WP_001078310.1.67798 WP_001078310.1.67800 WP_001078310.1.67808 WP_001078310.1.67931 WP_001078310.1.68020 WP_001078310.1.68233 WP_001078310.1.68334 WP_001078310.1.68392 WP_001078310.1.68747 WP_001078310.1.68773 WP_001078310.1.68931 WP_001078310.1.69016 WP_001078310.1.69162 WP_001078310.1.69412 WP_001078310.1.69483 WP_001078310.1.69489 WP_001078310.1.69520 WP_001078310.1.69639 WP_001078310.1.69721 WP_001078310.1.70266 WP_001078310.1.70457 WP_001078310.1.70541 WP_001078310.1.70672 WP_001078310.1.70850 WP_001078310.1.70994 WP_001078310.1.71027 WP_001078310.1.71179 WP_001078310.1.71266 WP_001078310.1.71280 WP_001078310.1.71301 WP_001078310.1.71404 WP_001078310.1.71428 WP_001078310.1.71438 WP_001078310.1.71483 WP_001078310.1.71541 WP_001078310.1.71547 WP_001078310.1.71771 WP_001078310.1.71800 WP_001078310.1.71828 WP_001078310.1.71836 WP_001078310.1.71981 WP_001078310.1.72257 WP_001078310.1.72489 WP_001078310.1.72529 WP_001078310.1.72760 WP_001078310.1.72874 WP_001078310.1.7294 WP_001078310.1.73489 WP_001078310.1.73536 WP_001078310.1.73547 WP_001078310.1.73687 WP_001078310.1.73837 WP_001078310.1.74025 WP_001078310.1.74985 WP_001078310.1.75521 WP_001078310.1.75590 WP_001078310.1.75704 WP_001078310.1.75805 WP_001078310.1.75944 WP_001078310.1.76104 WP_001078310.1.76123 WP_001078310.1.76659 WP_001078310.1.76869 WP_001078310.1.76895 WP_001078310.1.77144 WP_001078310.1.77583 WP_001078310.1.77860 WP_001078310.1.77883 WP_001078310.1.78324 WP_001078310.1.78638 WP_001078310.1.78978 WP_001078310.1.79059 WP_001078310.1.79156 WP_001078310.1.79400 WP_001078310.1.79452 WP_001078310.1.79737 WP_001078310.1.79854 WP_001078310.1.80152 WP_001078310.1.80181 WP_001078310.1.80286 WP_001078310.1.80317 WP_001078310.1.80393 WP_001078310.1.80647 WP_001078310.1.80762 WP_001078310.1.8077 WP_001078310.1.80845 WP_001078310.1.80972 WP_001078310.1.81224 WP_001078310.1.81243 WP_001078310.1.81387 WP_001078310.1.81532 WP_001078310.1.81738 WP_001078310.1.81789 WP_001078310.1.81829 WP_001078310.1.81982 WP_001078310.1.82017 WP_001078310.1.82234 WP_001078310.1.82315 WP_001078310.1.82455 WP_001078310.1.8261 WP_001078310.1.82664 WP_001078310.1.8288 WP_001078310.1.8302 WP_001078310.1.83021 WP_001078310.1.8319 WP_001078310.1.83250 WP_001078310.1.83597 WP_001078310.1.83792 WP_001078310.1.83816 WP_001078310.1.84194 WP_001078310.1.8432 WP_001078310.1.84673 WP_001078310.1.84679 WP_001078310.1.84714 WP_001078310.1.84736 WP_001078310.1.84874 WP_001078310.1.84951 WP_001078310.1.85133 WP_001078310.1.85198 WP_001078310.1.85265 WP_001078310.1.85331 WP_001078310.1.85354 WP_001078310.1.85391 WP_001078310.1.85401 WP_001078310.1.85425 WP_001078310.1.85549 WP_001078310.1.85562 WP_001078310.1.85634 WP_001078310.1.86136 WP_001078310.1.86153 WP_001078310.1.86197 WP_001078310.1.86331 WP_001078310.1.8641 WP_001078310.1.86455 WP_001078310.1.8663 WP_001078310.1.86916 WP_001078310.1.87236 WP_001078310.1.87534 WP_001078310.1.87593 WP_001078310.1.87636 WP_001078310.1.87682 WP_001078310.1.88212 WP_001078310.1.88339 WP_001078310.1.88445 WP_001078310.1.88504 WP_001078310.1.88572 WP_001078310.1.88638 WP_001078310.1.8877 WP_001078310.1.88881 WP_001078310.1.89027 WP_001078310.1.89108 WP_001078310.1.89139 WP_001078310.1.89216 WP_001078310.1.89372 WP_001078310.1.89476 WP_001078310.1.8950 WP_001078310.1.89556 WP_001078310.1.89557 WP_001078310.1.89603 WP_001078310.1.89686 WP_001078310.1.89799 WP_001078310.1.89924 WP_001078310.1.90095 WP_001078310.1.90145 WP_001078310.1.90345 WP_001078310.1.90370 WP_001078310.1.90740 WP_001078310.1.90757 WP_001078310.1.90820 WP_001078310.1.91297 WP_001078310.1.9153 WP_001078310.1.91624 WP_001078310.1.91660 WP_001078310.1.91746 WP_001078310.1.91909 WP_001078310.1.91919 WP_001078310.1.92147 WP_001078310.1.9237 WP_001078310.1.92546 WP_001078310.1.92688 WP_001078310.1.93198 WP_001078310.1.93263 WP_001078310.1.9330 WP_001078310.1.93374 WP_001078310.1.93538 WP_001078310.1.93647 WP_001078310.1.93669 WP_001078310.1.93975 WP_001078310.1.94093 WP_001078310.1.94182 WP_001078310.1.94229 WP_001078310.1.94407 WP_001078310.1.94625 WP_001078310.1.94838 WP_001078310.1.95002 WP_001078310.1.95442 WP_001078310.1.95535 WP_001078310.1.95552 WP_001078310.1.95631 WP_001078310.1.95640 WP_001078310.1.96105 WP_001078310.1.96364 WP_001078310.1.96424 WP_001078310.1.96477 WP_001078310.1.96489 WP_001078310.1.96578 WP_001078310.1.96637 WP_001078310.1.96638 WP_001078310.1.96718 WP_001078310.1.96956 WP_001078310.1.97033 WP_001078310.1.97146 WP_001078310.1.97302 WP_001078310.1.97409 WP_001078310.1.97460 WP_001078310.1.9748 WP_001078310.1.97575 WP_001078310.1.9758 WP_001078310.1.97641 WP_001078310.1.97742 WP_001078310.1.97953 WP_001078310.1.98548 WP_001078310.1.98559 WP_001078310.1.98710 WP_001078310.1.98805 WP_001078310.1.98807 WP_001078310.1.98912 WP_001078310.1.98981 WP_001078310.1.99027 WP_001078310.1.99081 WP_001078310.1.99174 WP_001078310.1.99228 WP_001078310.1.99331 WP_001078310.1.9974 gi|404479487|ref|YP_006710917.1| gi|386729900|ref|YP_006196283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]