SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy01g00500 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g00500
Domain Number 1 Region: 697-866
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.02e-59
Family Polyphosphate kinase C-terminal domain 0.0000697
Further Details:      
 
Domain Number 2 Region: 288-470
Classification Level Classification E-value
Superfamily PHP14-like 1.84e-48
Family PPK middle domain-like 0.0005
Further Details:      
 
Domain Number 3 Region: 522-692
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-48
Family Polyphosphate kinase C-terminal domain 0.0000227
Further Details:      
 
Domain Number 4 Region: 180-284
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 4.84e-26
Family PPK N-terminal domain-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy01g00500
Sequence length 1002
Comment chrom=[bathy_chrom_01] coords=[;82765..85773;] status=[complete sequence]
Sequence
MIVLAGSSVSSVSSVCCSQQQRRVLRPRQQFCRRRLVLLRVEDDDDDSRNKRRPNFVVHS
SSSLFSKRRTSPSSKICAASSSNNNGVTNYNQLGGKRRGKLNGAGVVTKLVKKDTQFEQL
GLSPDELEQYNQETAGYKSIINAALEVLLETCPPFIPEGTETDVERFKDEDIESFTLNDK
IFNPEMSWLAFNWRVLAAAADENIPAFERLRFLAISGRNLDEFFAKRVGALKRQESVGVG
NLVKKRGKNIWSPRKTLEYVSAEVEKMSDIQAELYIEQIAPSLADYNIRILSHDDMDKET
VQKVREWYHDYVEPILDPRAIDPCHPFPFLPSLSIALAVELEDAYSNEKFAVVSVPSVVD
RWIDVGEFMDETKGKLFLPLEQILEANMDTLFQGCNIRACHAFRVCRNADVERNEEEAED
LLEMMSDEVRTRRFASFVRLEVQDTMPEHVKDRLMKSLELRSFDVTSVPHAAPLGFGVLD
SIDVSFEMDDALVFDHWSPRTHPRLVGIDVPSSSASEAEEMSKRNIFDEIKKGDILVHHP
YHSFATSTQAFFEAAARDKDVLSIKSTLYRTSSNSPIISSLIKACDNGKNVAVLVELKAR
FDEERNLGFAERLETAGCNVAYGVKGVKTHCKATLVVRREGEKLVKYVHLGTGNYNPSTA
GIYTDYGMFTCKEEYGEDAVNLFKFLMGHHFQKEFNRLLVAPQSLQSSMVDLIENEITAA
KKGYKASITAKMNGLDDPEICKAFYRASQAGVSVNLIVRGICRIRPGVPGISENIRVISI
IGRFLEHHRCFRFENALQTGKADPKIYMGSADLMRRNLLHRVEVVTLVEDERIRCEIQDM
LDACLVDGVLAWELGADGRYHRTPEARAIAAKHSSQDPGKGKLMPIAATKGLHASLMVDV
LKKRSKSKTKQSVAGIAAKNLKYAARMPKQAMVKSAEDMAQPEKLEKAESAFPVSSSSSS
SSDKRPSMHEIIDANARPIEGEKVINDTSEDSMDDVAFDMEV
Download sequence
Identical sequences K8EZF3
XP_007515769.1.44737 Bathy01g00500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]