SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy01g04640 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bathy01g04640
Domain Number - Region: 357-406
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.017
Family MgtE N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy01g04640
Sequence length 559
Comment chrom=[bathy_chrom_01] coords=[;856875..858554;] status=[complete sequence]
Sequence
MSHHRGGAGGNQHLHYDGTYGPISPSNSPDIPSPRQWTEPPPSPSSKSSFSARERLETLK
RNKSRTKNIRNMFPRMERIALVILVVVFWTQQMYSNFTMMPGKGSLEKEHEHVLGGGGVR
RGGGGVLTSTNRKKSNGNNNVVRFTTSDLNSGIHTETRRVRREGTANRKESIGSSKEKDA
AASGAGTPARPATPRWFTRQAREFWKVYEDDVAMNCPEGTDEEEGCALPQETYVNFAKLS
INDQTATLKHLGLPAIRARDLLLNGVSDADKQSLLLLSVDATRAKEIIEYTATLPALKLI
KRGILRSPRKVLAVLAALNDKTEALDRILPHLTTTRGGSAGSSENENEEHRHPHHQRLHK
QPLRPFLSWFPDADIAELLSASSALQASIAVETLSLKKLADVFTRMLTPPSKETATSSST
STSGSSGSRASAAAKRHSTGSSSTAAAKTIAMILEASRRSQAAKILARLDLDSQTLLYSK
MDEATAEALKSRVSLISPESIEEEDESVARTDETQTFDFAQINDAIQSVNKDIKSSEEKA
KNERDKMEKAGLSWRGVGW
Download sequence
Identical sequences K8EA19
XP_007515778.1.44737 Bathy01g04640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]