SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy05g03480 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy05g03480
Domain Number 1 Region: 10-233
Classification Level Classification E-value
Superfamily Hsp33 domain 1.31e-49
Family Hsp33 domain 0.0000168
Further Details:      
 
Domain Number 2 Region: 256-302
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0000000000144
Family HSP33 redox switch-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy05g03480
Sequence length 304
Comment chrom=[bathy_chrom_05] coords=[;627535..628449;] status=[complete sequence]
Sequence
MTTKNNSNKDDEVYRVMSKNQELSVISVTATKMVAEAQGRHKAAPTATAAIGRNLIASLL
LGSFKGDEETVQVTFRGDGPLGQLTAVSDNLGNAKCLVGNALADPPLRPDGKLNVGMAVG
KGILSVSRSHPSWVQPYNGQVSIYTGEIAEDIAVYMRDSEQTNSAISVGVQLDRELTVVG
AGGYMVQVLPFASDETLDYLEKHIPTLDSPSTMVESGMTAEEIAKAILGDLGAFEEVETR
LTPKYGPCCREELEGRMLKAVASLGREEAMKIIEEDGKIEVTCEFCKEDLVFNEEEIEKA
LQGI
Download sequence
Identical sequences K8EVJ1
XP_007512917.1.44737 Bathy05g03480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]