SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy11g02200 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy11g02200
Domain Number 1 Region: 868-957
Classification Level Classification E-value
Superfamily E set domains 5.67e-16
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 2645-2736
Classification Level Classification E-value
Superfamily E set domains 0.000000000000867
Family Filamin repeat (rod domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 3210-3298
Classification Level Classification E-value
Superfamily E set domains 0.000000000014
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 4 Region: 2190-2272
Classification Level Classification E-value
Superfamily E set domains 0.0000000000207
Family Filamin repeat (rod domain) 0.0037
Further Details:      
 
Domain Number 5 Region: 1960-2048
Classification Level Classification E-value
Superfamily E set domains 0.0000000000327
Family Filamin repeat (rod domain) 0.0054
Further Details:      
 
Domain Number 6 Region: 526-640
Classification Level Classification E-value
Superfamily E set domains 0.0000000000347
Family Filamin repeat (rod domain) 0.0079
Further Details:      
 
Domain Number 7 Region: 2282-2377
Classification Level Classification E-value
Superfamily E set domains 0.000000000167
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 8 Region: 2838-2942
Classification Level Classification E-value
Superfamily E set domains 0.000000000223
Family Filamin repeat (rod domain) 0.0071
Further Details:      
 
Domain Number 9 Region: 3569-3684
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000000514
Family MgtE N-terminal domain-like 0.0086
Further Details:      
 
Domain Number 10 Region: 1087-1176
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000000602
Family MgtE N-terminal domain-like 0.0057
Further Details:      
 
Domain Number 11 Region: 4098-4171
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000000017
Family MgtE N-terminal domain-like 0.007
Further Details:      
 
Domain Number 12 Region: 4677-4766
Classification Level Classification E-value
Superfamily E set domains 0.0000000193
Family Filamin repeat (rod domain) 0.0017
Further Details:      
 
Domain Number 13 Region: 1865-1953
Classification Level Classification E-value
Superfamily E set domains 0.000000024
Family Filamin repeat (rod domain) 0.025
Further Details:      
 
Domain Number 14 Region: 3794-3875
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000000602
Family MgtE N-terminal domain-like 0.0068
Further Details:      
 
Domain Number 15 Region: 5027-5128
Classification Level Classification E-value
Superfamily E set domains 0.0000000734
Family Filamin repeat (rod domain) 0.0094
Further Details:      
 
Domain Number 16 Region: 4920-5013
Classification Level Classification E-value
Superfamily E set domains 0.000000113
Family Filamin repeat (rod domain) 0.0084
Further Details:      
 
Domain Number 17 Region: 356-430
Classification Level Classification E-value
Superfamily E set domains 0.00000012
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 18 Region: 4292-4381
Classification Level Classification E-value
Superfamily E set domains 0.000000147
Family Filamin repeat (rod domain) 0.0091
Further Details:      
 
Domain Number 19 Region: 3316-3415
Classification Level Classification E-value
Superfamily E set domains 0.00000107
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 20 Region: 1016-1081
Classification Level Classification E-value
Superfamily E set domains 0.0000018
Family Filamin repeat (rod domain) 0.0073
Further Details:      
 
Domain Number 21 Region: 4825-4912
Classification Level Classification E-value
Superfamily E set domains 0.00000567
Family Filamin repeat (rod domain) 0.0089
Further Details:      
 
Domain Number 22 Region: 667-760
Classification Level Classification E-value
Superfamily E set domains 0.0000153
Family Filamin repeat (rod domain) 0.0075
Further Details:      
 
Domain Number 23 Region: 3859-3956
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000235
Family MgtE N-terminal domain-like 0.0065
Further Details:      
 
Domain Number 24 Region: 2117-2199
Classification Level Classification E-value
Superfamily E set domains 0.0000274
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Domain Number 25 Region: 4131-4268
Classification Level Classification E-value
Superfamily FliG 0.0000314
Family FliG 0.03
Further Details:      
 
Domain Number 26 Region: 1623-1702
Classification Level Classification E-value
Superfamily E set domains 0.0000487
Family Filamin repeat (rod domain) 0.011
Further Details:      
 
Weak hits

Sequence:  Bathy11g02200
Domain Number - Region: 1507-1600
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000111
Family MgtE N-terminal domain-like 0.016
Further Details:      
 
Domain Number - Region: 2970-3049
Classification Level Classification E-value
Superfamily E set domains 0.000667
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Domain Number - Region: 2771-2854
Classification Level Classification E-value
Superfamily E set domains 0.000771
Family Filamin repeat (rod domain) 0.026
Further Details:      
 
Domain Number - Region: 1169-1269
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0017
Family MgtE N-terminal domain-like 0.008
Further Details:      
 
Domain Number - Region: 5167-5263
Classification Level Classification E-value
Superfamily E set domains 0.0175
Family Filamin repeat (rod domain) 0.017
Further Details:      
 
Domain Number - Region: 468-546
Classification Level Classification E-value
Superfamily E set domains 0.0214
Family Filamin repeat (rod domain) 0.0092
Further Details:      
 
Domain Number - Region: 3128-3223
Classification Level Classification E-value
Superfamily E set domains 0.07
Family Filamin repeat (rod domain) 0.024
Further Details:      
 
Domain Number - Region: 1715-1815
Classification Level Classification E-value
Superfamily E set domains 0.088
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy11g02200
Sequence length 5392
Comment chrom=[bathy_chrom_11] coords=[;397548..413726;] status=[complete sequence]
Sequence
MFSRKGTGGTTTGPTSSSKLVMKSKGWKADKYEFQVTVRSVYNLLPGTKRTQLLVKRGSK
VAKTQIVDASNGECDFNDEVLSISTSLFVNPRTGEYESKPMLLTVKEIMSKTKTRVYAES
KIDLMDFCLQPGKEITKTVPLKTGKGEKTVQLTHVQFSVRAIPVAEGVAFSEISSDASIA
NLSDFDEDDVAEGRKKKRREQDINAELESVLEEEEFEESFVPSVSEDLSPPQRGSDPTAS
SDVGGARAYSTAKKRSKKANVSYGDDDDDDDDDYQEDKESMYSSEDDVRVNSDENNKIQT
GALGYDYNADSAFVYRGEGQNNEIQQAPMQGQLRFENVDGGVEATDTLVPGNRSLRLMVN
RNCKINVRVIDRFGNPRARGGDDVEAVVVHTETNERASCKVTDHGDGSYLLDFSCPSAGV
WMLRCAYNGRLSNEVHKLVVSHGPLTATDLILDLPQGTQPCGGYAPVRVRIARPEDGRQF
SGAEGFQVKLTAPSGVSVGIPIECQPGSIEAVGTICWPEVGENWVSVTLDGRSLPGAPHA
VQVAPEVACLAASQITGPGAHKCIAGERATFIIETRDQRGNRLREGGFDLEVSLKCKTKA
GNDERFRGEIIDFGNGSYEASYVCKVAGNFELVVALGEEELNMKAICEPNVAVIQSCVLL
GDSNLDLIVGKEGRVTIQRRDAYGNDCPSRQGQLAFRCTIDGPGLAKCDVIDGSYGRSDV
VVKCTIIGRYFVSVSGGEHMDSLPGAPFEIVVTPSIAAGSACVTSIYGAQLASPDSDALV
AVAGDEVIANVSPKDIYGNATSFTSDQSIFFTAVMDDEEYHFENRGGPRAEATLSASFQT
AGSYLLSADAAEEPLAGYPRILIVVPGATDPSKCMVFGEAAAGVRVGRPSHLTIHAADKF
GNLRATGGDVLDMTLVSPDGRSVVTAKVVDHSDGTYGCEFKLDQPGMWDCQLVVNGQTGR
SDVQSILAEYGPVIAQECSFVGLGSDNLGGVVCFENGTITIYPNHAGNGTVNDTSVGRRF
NGTEAMTTRILLPSGEVAEVKLTFENGVYTGTYRWTQVGMHTISVNLSQEAIIGSPYNVE
ILLSLPQIPENLSAREIADMLPNLLPEGAAQALSNLSPKDAADAIQGQDVENVARMLSGV
MPGTCAEILSELPPKDAADILGAMRDPTDVLLAMSTEDLAKILASADPEDNAKFLDALKQ
LSPGDLGPLLKNLDRGNLEKLCEDIDIADVVGKCKDKKDKAGILARLPPRLVPKAMRTLD
VKERAEMLEMIETMRREAGFSESTSGDGWNWIDLIAGCSNAWLSDPSLPAHERQTRRQNA
LERLENLAPVMIDISCKGGCALYEAGFDDADGEDVAVVVYALLLADDTGGVMQTKDETNS
NHALSFFRCCREDQRIVALPFLLDNKSFGRLALEMTPEELADLLKDQDSSTVERAFCQVC
KHKGHELAANAANLLDPVLAAEAISISLQPDSNCDLSGMFQFLIAEILALIDPLEALGKA
CEGLMNAHDILGKLSPEDACRALRGMSPDEVTKMLRNLKGGDLDSESSLANAVALYAAGL
SPEAAAALIEDIDPNFAISFVSLMPEQMIQNIMKHLKRRDLKDRILNRSTLCLPQCTVKF
AEYQCIAGIPAKIVIEAREKGGSRIPHGGAQLSVFTRPADSKLASQMEPIEGEIKDRGNG
DYEIIYVSKTAGPIEVVVLGNSEEAIYDSTCYAGDCDVLKSTLDKSGLDEWKAGEGGLLR
LQLVDAYGNKIDANDCVLDFKVRCVGPGTVKASNKRLPMPDGRIEFELETNTTGVYTITV
SCVDTNEIIPTTPFEAAMVTGKLSHAGCKAVLQTLTSSTKGFKLDNGFNGAKGDKSKKSP
LVCAAMAGEEVTALVDACDRYGNPTVFKGETVTVSASGPAHLPQERAFEVADMRGGRVIL
RTICPRAGSYVVHVAVDGIPIAASPLALHVFPGPCVTGRATLRGDALAGVLAGHVSRLTV
QTEDKYGNNCHGGGDRVDLSIISSGGNKSTCLDVHDHGDGSYTAEFVVPTAGRYTCSAVI
NGKVAKESTVELIATYGPVSASGCILRAAPGVEHSKHVDRVAGLIGAGNNNDNVVIDTCG
SLRDIYVQSLEFEATGRGMSGKEACSVHLIAPSGASHTLAVSFAERGARYKASARWWEVG
RHEIVATINGEPIVGSPLIVDVEAQNLSLPMCRLSGPGLQGAVAGEKATILIEARDARGN
RLFTGGALLGLAIRSGGDTTRGKVFDLGDGTYEAAYVVERAGPFELSLFLGSEAATFRAN
CVPGRVDYAKCRVDGATHTRWIAGQQLAFTVTRVDRFGNRVPRREGLAPLYGYGVGPNNA
EVAVESLELGNGTCEIRYTATVAGTYNLGVYVADAPLLPFMNEEAEELMHYGRTEGKTKA
LPGVESHEGEDVYSKAERQKRIEAKTTEYDEHAKTIIDDKGKTRRILIANKALERDDALA
GAVKSAQKKGYDERNSKITFEERTAVAIAGGQSISELPKSLQKVNAADGTMLFPLPRGVF
EIPLVAAVAEPQNCDLIVVGARQRNGDDYDTNGGSKASWVAPAGENVLVCVTARDRFGND
TSWEEGQVIQVQAQGPEFFAFDVTGATSRQTDFTSKMTRAGTFELRVLCDGLPVCWRVVQ
IIAGPTHPDRCFLSMEGLKDVKTGDLVRLTLRAVDQYANLRVQGGDDVQLALEGPNGAYA
RGASVVDHGDGTYALEFGVTVAGRWILSVRINGQPLIEGGIAFHVAFGTLTAEEADITLN
PALDARGAAECGTTTDLIIVGAGFEVNKRLMTGLEAISVVLTLPSGVSESLRCTLAKDMT
RYVAKIRWLHPGVHHIAVLINGIRVPKTPIRVIAEGREISLSACVVSGEGATRCIAGEPA
KFRLHARDYGGNPINFGAAEKIHVEARCPGESPIAASFLNNQDGTYDFEYVCTKAGKVDL
FIALQTKNPSSRTLNCVCEASWCEPSECRVDASKMLVQWLAGEPGIVRVQRRDRYGNPTR
RSAKNGLNRFAAEVVGPAVVDCEALELGDGTCELRLRAAASGVYEIDVLAVAIDATNIVD
DIAGGGAILGEADPELVATFVAECESTQTFPAACVARIALQIDPLDESAGEERLGEHDSD
ASLPATIVAGDKVNVYVLPRDAHGNKTQWTGGERIAVHGKGPTEIAFAPGDDVGAFSATF
TDAGTYCVSALVGDSSCAGWPRTVQVVAGPADANACIISGEALSRSTTATETTLMLQAAD
VFGNMRSMGGDLVEATIKTEHDGYVDCYVEDVGDGTYVLRFEMDEPIRHDVHLSVNGVKE
KISRYSLSPSLGVLIAGECVVRGVGGERPELHDTQTLFVQPANPSRVMSGREAIVCTVHT
PSGLAFNTPVVFNPESRHFWSKLFWVELGNHSVCVTLDGDILPGCPFVVRVRDPNQEAYD
EFMLDARERAPSSAVRANNAFGYVYGTDTHGPFPDYFDWADDNDDDDEMSSTEHQVIFGS
ANSNEPRITAQQAEAALHALRSQPSLEAAAEMLCGMKPNLAGACLDMMEPEEAASVLAAM
QDERALAAAFVAMEEDNASAALYAGTAEEREKILNAISPMAAATLLTRMTAQDAANILSD
ASAEARANILRSMSPKKAAEIMARFSEVYPHLMRETFGALDANYAARLLASMPNLTDVDP
EVVALVLSRVDSDVASNLLWKLQSTPANAEVAAAALCVMAMTDIDLAAKHYATLLVSGKP
KSERLDEALRATSIGTKIADLAENLVATGAVTPPPVNLSGEALGGNAASSGEIKEHRWGA
NGVKPSKSATLRAAKSLEGVPPKVAAQALADMRAAAAGAVLATMDAERAAQIIANMNPKK
LAEAISQMELDDAKRVFASCKRGDRANILENLSLEASGSLVGALDPQSAVEALKMIEDEN
KVMDILRRVKPPSALAAILMQYTADKTAEIFSKLTPQQSASAMSSMFASSQEGARKLNAA
LALMKPDEVALRLQALLPLDPHAASELLYSMPEPTRSKVYARMESKDSGKILHNLSPKRG
MEILANASVIEATPKTLSSSLESLSKYGPSWANQKQAEHETTKSRGVVADCLLKLWHESN
NVHKQKDAEQKVTSKKACIDCLETMDAKVAAHAIGNMTPKDAADIVSALTPETAASILTN
MSESKRAAMLLKMTPEAAAACLKYLSLDDASAAIRAILETDDEDAIKRASQILAAADPFR
AGEILTSISSNMETVRTAIKNMPSSAVANIFAAGAVEPDIAAKIIDGLDMDIADGIIAAL
PPANADQICNLVKDDELRNRAADRAIVVLASSKLEGDGWQKATAGIEAEFIMLSTNPAGK
RIFKGGAKINCAVYELDIANKRTSKIPIQAKVEDLRDGSYAIRYTCLKASPHELSITCAG
QERKARIIVVPGEVDPKSCVVLDYAITRKEITTASDGKKKLKASGDEEKNYEIIKTPLKK
YVWRSGDVVEIPMICADKHGNIVPPPKHEDLTSTFAIVADGDGPGTVEADIGRIESFDKN
DKHGPTAVARFRATACGSYTLLVFTADNQKKWWERGGKAESPIRGAPIKLDLVAGAADGS
KCSARVEGVKERAGAVLIAVAGREIDAYLDAFDAYGNACSFDADQKVRVDCAGASDLLLR
EASKKDLKKKKSAINVNEKAFSGTLTKAGSYSMRATVDGKICAGFPKVLQVVANEIDAKT
SVLKGDALAEKQVRVGTPTHAIFLANDSFGNARLEGGDNVEIVLKSNDFIDEGLEVDANV
EDHADGTYSVRFTLPKSGKWTVHLKCWPDKGEKPEQSVRMSFNSFVTGDAGTKSQDVSNT
GVIECLRGKVNALTLKCLESKPMFFVGAETAFTLQSTDFDASHREVGGKEAVCARLLSPS
GVSSIIPLKLTKDKIRYRAVVRWPEVGRHTLFANLDGEPLVGSPFTCDVKPAEICLPLSE
ITGSGRTECVAGKRSSFIIRARDHRGNRLRMGGSPIECVVTSIIKAEDKRVERREDTIVN
TEGSVLDQGDGSYVVSYFVDIAGKYEIELVADDSRRSLHGICEAAEADPNRCQIDASGLR
NLEAGMVGIARILRCDKFGNVLKAYPDSLPFRVEASGAGPAEIETVEAGDGSCDVRFEAR
VAGRYTLYVWSGYKRDPVKGAPIEVRVSPGQAAAAHCVATVEGAHDDQGFISSNTNSSIT
PNVGQINARAGDFLTIKMHARDRFGNATVWKEWQTLEVRASGPRDVRFEEIQSKSSGGGS
QIRGQFRSMFSKAGSYVVWVTVGGQAVVGWPRVIHVSPNVTDADQSKMRPEAETLALMSE
LVTSNQRGNRMLLGAPVRDRGAFGQRTLAGATMAEDEDNVDQLRRETEALKIKLAEYERA
AAVVAMAAQKGVEAELKQQQQQQHVVVTKVVKGGGKQQRQLRDIESETEEEE
Download sequence
Identical sequences K8FA16
Bathy11g02200 XP_007510093.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]