SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BathyCg00284 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BathyCg00284
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.000000000222
Family Subunit XII of photosystem I reaction centre, PsaM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BathyCg00284
Sequence length 31
Comment chrom=[bathy_Chloroplast] coords=[;20913..21008;] status=[complete sequence]
Sequence
MSLSDTQVFVALFVALITGLLSVRLGTQLYK
Download sequence
Identical sequences K8F0W7
BathyCg00284 YP_009056869.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]