SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bm1_21880 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_21880
Domain Number 1 Region: 202-389
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-46
Family cAMP-binding domain 0.00043
Further Details:      
 
Domain Number 2 Region: 55-107,138-238
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-29
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_21880
Sequence length 483
Comment | Brugia malayi Voltage-gated potassium channel, HERG
Sequence
XKCNHXXXrelatedXCXelegansuncXXXXorthologXXXXaaXTTTLIGLLKTARL
LRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLGCIWYAIGSAELPHKEFTWLHQLAR
HLNEPYLSTNGSVPTGGPSLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMIL
GSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSY
TNGIDMNTVLKGFPDCLQADICLHLNRNLLNNCPAFAGCSPGCLRALSMRFRTTHAPPGD
TLVHRGDVLTGLNFIARGSVEILKDDMVVGILGKDDIFGENPLLHEDVGKSSCNVRALTY
CDLHRILRDDLLDVLDIYPEFAENFCRNLTITYNLRDEAQSMRKRLDRHKLLRMSSSLDK
DKISSIQREGSLEKRDDFVTRTERTTLQSYRRRVERTSLTKKDKKAYHKIVNNPVLGNQC
FFF
Download sequence
Identical sequences Bm1_21880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]