SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|402568362|ref|YP_006617706.1| from Burkholderia cepacia GG4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402568362|ref|YP_006617706.1|
Domain Number 1 Region: 73-151
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 3.93e-31
Family CO dehydrogenase ISP C-domain like 0.00055
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.69e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|402568362|ref|YP_006617706.1|
Sequence length 153
Comment 2Fe-2S iron-sulfur cluster binding domain-containing protein [Burkholderia cepacia GG4]
Sequence
MPTSFVLNGKSVTLDADPSMPVLWAIREHAGLTGTKFGCGMAQCGACTVHLEGQAVRSCV
LPLAGIADRHITTIEGLQSKPAQAVQAAWVKLQVPQCGYCQSGQIMSATALLEQNPKPTD
ADIDAAMNGNICRCATYARIRAAIHDAAATLGA
Download sequence
Identical sequences J7J708
gi|402568362|ref|YP_006617706.1| WP_014898784.1.68957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]