SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra012545 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra012545
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.86e-19
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 126-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-17
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra012545
Sequence length 249
Sequence
METPREPHFFKPLLPGFQSGVAIPLDFYSKHIQGAEINKPWKLRSDASDKIWEVIREGRT
LTKGWKEFTEAHDLRIGDIVIFKHEGDMVFHVTPFGPSCCDIQYTHPHIVKEEADADDAP
TFSYDYCFLAEVTPTNQKDDKMFLPVEAMRCGALNQQCKEVKLVNKEGKSWTARFGFSES
DGAYYISRGWRKFCRDNRCTNGDLFVFNVVGDGTTTPLLCVCPERKECTELLIKHFSRID
GSIASTSRN
Download sequence
Identical sequences M4D7T5
XP_009137010.1.100322 Bra012545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]