SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra013963 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra013963
Domain Number - Region: 13-86
Classification Level Classification E-value
Superfamily OmpH-like 0.00785
Family OmpH-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra013963
Sequence length 151
Sequence
MLRNIVDLVEASLFSDNPEWRPEVSELETKLSEQAKILSNLQQKVDDLAAKHAYNPDEEY
AEVESELRDRLESFLETARAFNTIYTKFLGNMKNLRGSHAALSIGSSGGTVAGEPSSVTR
IVSECEAALTVLNRDLGILSASIAREQGERL
Download sequence
Identical sequences M4DBV3
Bra013963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]