SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra016412 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra016412
Domain Number 1 Region: 69-271,392-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-60
Family Tandem AAA-ATPase domain 0.000000561
Further Details:      
 
Domain Number 2 Region: 443-549,645-728
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.43e-41
Family Tandem AAA-ATPase domain 0.0000386
Further Details:      
 
Domain Number 3 Region: 750-860,915-1023
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 6.67e-41
Family Helical scaffold and wing domains of SecA 0.00076
Further Details:      
 
Domain Number 4 Region: 270-391
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 6.41e-37
Family Pre-protein crosslinking domain of SecA 0.0000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra016412
Sequence length 1026
Sequence
MGTVLNLVNPPNTTPCLLSPSNKFPWTKPFLSGVFIARPVTPIQRCHVVRRSRVSASLLG
NLGRLKRNLQDVTSMNYWVVRDYYRLVESVNSIERQIQSLSDEQLKAKTLEFRERLARGE
SLADLQAEAFAVVREAAKRTIGMRHFDVQIIGGGVLHDGSIAEMKTGEGKTLVSTLAAYL
NALTGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQELGFDYLRDNLTSNSEQLVM
RWPKPFHFAIVDEVDSVLIDEGRNPLLISGEANENAARYPVAAKVAELLVKDIHYKVELK
ENSVELTEEGISLAEMALETGDLWDENDPWARFVMNALKAKEFYKRDVQYIVRNGKALII
NELTGRVEEKRRWSEGVHQAVEAKEGLEIQADSIVVAQITYQSLFKLYPKLSGMTGTAKT
EEKEFLKMFQIPVIEVPTNLSNIRIDLPIQAFATARGKWEYVRREVEDMFGQGRPVLVGT
TSVENSEYLSALLKEWGIPHNVLNARPKYAAREADFIAQAGRKYAITISTNMAGRGTDII
LGGNPKMLAREIIEDSILSYLTSEVLADDIDDNELSQKVLSKIKVGPSSLALLARASLMA
KYVGKSESKSWTRKKAKSVVTESLEKSQTMDALELQNLVNEQSEMYPLGPAIALAYLSVL
KDCEAHCLYEGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEM
FQKFNFDTEWAVRLISKITNDEDLPIEGDTIVKQLLALQINAEKYFFGIRKSLVEFDEVL
EVQRKHVYDLRQLLLTGDNESCSQHIYQYMQAVVDEIVVGNSDPHKHPRNWNLAKLLKEF
MAISGNLLDEGTMLQSLENLHETSSIDMDNFHLPHLPKPPNAFRGIRRKNASLRRWLDIC
SDDLTGSGRYRTSVNLLRKFLGDYLIASYLSAVQESGFDDGYVKEIERAVLLKTLDCFWR
DHLVNMNKLSSAVNVRSFAHRNPLEEYKIDGCRFFISMLSATRRLTIESILQYWSSPMES
QELFVS
Download sequence
Identical sequences M4DIT5
Bra016412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]