SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra025868 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra025868
Domain Number - Region: 24-76
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0968
Family BRCA2 helical domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra025868
Sequence length 250
Sequence
MRTMVDLGKQRDRLHHRMQIINTPTTVDCAREIRLRRTLRSFIECMLPYCCTYQQQPAHS
YQNDTVSVSSSTSSDHSSSDHSSSSSSIVSGTFFGHRRGRVSFCLQDATVGSPPLLLLEL
AVPTAALAKEMDQEGVLRIALECDRRRSSSSNNSRSSSIFDVPVWSMYCNGRKMGFAVRR
KVTENDAVLLRMMQSVSVGAGVVPLDEEEQTLYLRARFERVTGSSDSESFHMMNPRGSYG
QELSIFLLRS
Download sequence
Identical sequences M4EAQ9
XP_009107493.1.100322 XP_009149583.1.100322 Bra014004 Bra025868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]