SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra030381 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030381
Domain Number 1 Region: 140-225
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.22e-26
Family Middle domain of MutM-like DNA repair proteins 0.0031
Further Details:      
 
Domain Number 2 Region: 2-145
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.19e-24
Family N-terminal domain of MutM-like DNA repair proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra030381
Sequence length 382
Sequence
MPELPEVEAARRAIADNCVGKKIKRVLIADDNKVIDGISPSDFQKSVLGKTIVCARRKGK
NLWLELDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDSEEWPSKYSKFFVELDDGLEL
SFTDKRRFAKPVSVRPISELGPDALLEPMTVDEFAKSLAKKKITIKPLLLDQGFISGIGN
WIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDAESSQFPSNWIFHARE
EKPGKAFVDGKKIDFITAGGRTTAYVPELQKLSGKDAEKAAKAKPAKRGGAKSKEDDEEE
ELEKEDDSAKPKNQKPKGRGKKPALKRKTKDSEDEDDDADGEEDESDAEEEVVKPRGRGT
KAAIKKKPEEKAGNKKPKGRRS
Download sequence
Identical sequences M4ENL1
Bra030381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]