SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra034056 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034056
Domain Number 1 Region: 94-208
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 6.54e-18
Family N-utilization substance G protein NusG, N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 274-325
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000531
Family N-utilization substance G protein NusG, C-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra034056
Sequence length 331
Sequence
MMKLQGGLLQWSPSSLIPSAIRTTRLSISACVVERKHELTARERRQLRNERRESKSGYSW
REEVEERLIKKPKKRYASWTEELNLDTLADAGQQWWVVRVSRVRGHETAQVLARALARQF
PEMEFTVYAPAVQVKRKLKNGSISVKPRPVFPGCIFIRCVLNKEIHDAIREVEGVGGFIG
SKVGNTKRQINKPRPVDDSDLEAIFKQAKVEQEKADSEFDEGERAEEEASLALQKALASN
SDGTETVESLAETKPKRAPRKATLATETKAKKKKLAAGSTVRVLSGTFAEFVGNLKKLNR
KTAKATVGFTLFGKETLVEIDINELVPEIQT
Download sequence
Identical sequences M4EZ13
XP_009123446.1.100322 XP_013724158.1.73403 Bra034056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]