SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra036062 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra036062
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-19
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 126-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-16
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra036062
Sequence length 249
Sequence
METPREPHFFKPLLPGFQSGVAIPLDFYSKHIQGAEINKPWKLRSDASDQIWEVIREGRT
LTKGWKEFTEAHDLRIGDIVIFKHEGDMVFHVTPFGPSCCDIQYTHPHIVKEEADADDAP
TFSYDYCFLAEVTATNQKDDKMFLPVEAMRCGALNQQCKEVKLVNKEGKSWTARFGFSES
DGAYYISRGWRKFCRDNRCTNGDLFVFNVVGDGTTTPLLCVCPERKECTELLIKHFSRID
GSIASTSRN
Download sequence
Identical sequences M4F4R3
Bra036062 XP_009127102.1.100322 XP_018509655.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]