SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra037060 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra037060
Domain Number 1 Region: 360-527
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.03e-49
Family BRCA2 helical domain 0.00058
Further Details:      
 
Domain Number 2 Region: 528-652
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.68e-35
Family Single strand DNA-binding domain, SSB 0.00018
Further Details:      
 
Domain Number 3 Region: 654-683,817-902
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-25
Family Single strand DNA-binding domain, SSB 0.0092
Further Details:      
 
Domain Number 4 Region: 684-817
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.000000000001
Family BRCA2 tower domain 0.0029
Further Details:      
 
Domain Number 5 Region: 1091-1143
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000353
Family F1F0 ATP synthase subunit C 0.012
Further Details:      
 
Weak hits

Sequence:  Bra037060
Domain Number - Region: 907-1021
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000158
Family Myf domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra037060
Sequence length 1158
Sequence
MSTWQLLPDSSGDGFRWDAAGRILQSGKSDSPPTTSPPLPSMADLLLRGCSKLIEPEESK
PTMFTTALGKSVALKDSSLSRAKSILSDSDDVALSRESGFGVPNSCFQTASNKKVNVSSA
GMARAKALLGLEEEDDFSVFKHVNHRLPSSHQQHGLRTPETFGAEHRSVTPGGHNVSGKR
CEILSSSPKVPQTKFQTAGGRSLSVSVEALNRARSLLGDPELGPFFDDVDHFVTPQKDKW
IGGDIAHESNKHTSNSFISPLQSSSKQFRSVKLEDVASGVNLIKKFDAAVDETHGNTPLA
SDKAVTNTMGTGFIPRSSQFGRQAHQPLVDITNRNDIAHANSNNRQESSQKKRLGKTVSV
PPFKRPRTSSFKTPLMKNDQHPSNGFSVVSCDTQYSNRVLSTRTEERSQRIYIKDYFGMR
PRATTKMAVPEHVRRIKSSNADKYAFGDVSSSSVVGAETFHQMLAESGASLQCASREWVT
NHYRWIVWKLACYETYYPAKCRGNFLTITNVLQELRYRYEREVNHGHCSAIMRILSGDAP
ASSMMVLCISAINPETRETHGSDSGNNVKIELTDGWYSINAALDVMLRKQLNAGKLFIGQ
KLRILGAGLSGWSTPTSPLEAAISNTIYLLLHINGTYRAHWADRLGFCKEVGVPLALNCI
KCNGGPVPKMLAGITRIYPILYKEKLGEKKSVVRSERMEWRMIELHNQRQVSIISCREQL
LVTFMRSDLIEGLICEYQGGINGVDSQNDTDSKGAKLFKLLESAAEPDFLMADMSMEELN
CFNRYKEKFEAAMEKKMEKSVAKALEDAGLGERDVTPFMRIRLVGLTSLSYDGHPNPKEA
ILTIWNPTETQRTELTEGKIYAMKGLVPMNIDSETLYLHAKGSSSRLQPLSPKASERFQP
FFNPRKSMSLLDLGEIPLGSEFDMAAYVVYVGNAYTDVDQKKQWVFVTDGSLQYSDSGKI
ANRLLAISFRTSSMDDLHSPLISHNLVGSVVGFCNLIKRAKDVENDMWVCEAMENSDYFL
NADAACPSHLKTSNHRPTSAESPTYRRCLLIISCTRSPADRSFHEEILITAAHATFYEFN
TEISQWWSPCVLAGLSAGMAIGIVGDAGISECTTTKALCGMILILIFAKALSLYGLIVGI
ILSSRAGQARVERTLKVS
Download sequence
Identical sequences M4F7J9
Bra037060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]