SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra001321 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra001321
Domain Number 1 Region: 100-134
Classification Level Classification E-value
Superfamily NTF2-like 0.0000394
Family SAV4671-like 0.026
Further Details:      
 
Weak hits

Sequence:  Bra001321
Domain Number - Region: 67-97
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0235
Family C-terminal UvrC-binding domain of UvrB 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra001321
Sequence length 143
Sequence
MGRSFRPKVINVGLVTSLCVGSNSKPSRDHFSVWWFLEATSLALSLIPYTGTAIHSDVDS
VSLDENTLKQDLEAEIHEENYVEAAKIRDILKELQEYNKASVLSANTRFYQAFRNGDLAE
MESLWSKSGKPCCVDELRVPVTD
Download sequence
Identical sequences M4CAU2
Bra001321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]