SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra003607 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra003607
Domain Number 1 Region: 105-202
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000000142
Family SnoaL-like polyketide cyclase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra003607
Sequence length 273
Sequence
MAFLLPNLSPSFLLQTGKSLKEKPISTHSLSISSSSSSTNSYEFEEGSLSLLSLPVQAPP
APGAQVKTMPNEKDKNQQQGKDEFYINLGLAIRTLREDLPLLFTKDLNYDIYRDDITLVD
PANTFSGIENYKLIFWALRFHGKILFRDISLEIFRVWQPSENMILIRWNLKGIPRVPWEA
KGEFQGTSRYKLDRNGKIYEHKVDNLAFNFPHQLKPATSVLDLVTACPASPNPTFMFGSS
YSSSWIEFYQAVQRTLDKQQDQIVMQDRFVICS
Download sequence
Identical sequences M4CHC4
XP_009104527.1.100322 Bra003607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]