SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra004005 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004005
Domain Number 1 Region: 10-130
Classification Level Classification E-value
Superfamily NTF2-like 6.58e-26
Family NTF2-like 0.0048
Further Details:      
 
Domain Number 2 Region: 235-354
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000047
Family Canonical RBD 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra004005
Sequence length 523
Sequence
MAAEGGALDARKASEAFVEKYYHTVGTMTHAAHTFYADDCIVTRPGPDGTTMSFSSLEAI
KKHYLSSYYDGTTFDVVNVDSQSSLGDGVFIMVIGFLTGKDNLKRKFSQAFYLARPNGVY
AVVNDIHRFVDEESSTTRALPVVESVPEATKPVEEIKNTAQVHKSTKKKSVKAAEVKKVA
TPEKAVTAEKPKEPVAETSATPALDGAKKSYASMVLSMSRNAAPVQVKAAPVQKPSTVAQ
PKPHVAPAPEKKSEQKMVDEPGTSIFVSNLPMDARPPQVYELFKGFGAIKGNGVQIRSSR
FSGSCFAFVSFESVASVKSVLKAAKNNQFKLGEHKLRVKEKQVEYNSSKPSGGRSEGGSM
SQSGSVDGRKTPAGSVDGSKTENVSVGGEEDDGFKVVRSRRNRSRSIGKYPLGISFGSFI
AVARSRSVNMYVGLLTLVSSGKYPMMLQILIKKTRILPEALARAKQAKLMVKPPNTLGET
RENALLALFSIKAMKELVQFDLRHQVYSLVRPVQQVKLLPVHI
Download sequence
Identical sequences A0A078EZ28 M4CIH1
Bra004005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]