SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra004556 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004556
Domain Number 1 Region: 101-194
Classification Level Classification E-value
Superfamily NTF2-like 0.000000000000465
Family SnoaL-like polyketide cyclase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra004556
Sequence length 237
Sequence
MAFLVRSPEIPTVSARSFPGSSSSVRHVFMRRKVTVSARDLSGVKNQKSRLYVKFSAPVK
EDCEISTKKEENKQNYYVNMGHAVRCLREELPSLFYKEPNFDIYRDDIVLRDPINTFTGI
DNYKSILWALRFHGRIFFKALCIDIVSIWQPTENTLMIRWTVHGIPRGPWQTRGRFDGTS
EYKFDKNGKIYEHKVDNIAVNSPPKFQMLNVKELVEAISCGTTPKPTYFSSSWLETY
Download sequence
Identical sequences M4CK22
XP_009142678.1.100322 Bra004556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]