SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra004962 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004962
Domain Number 1 Region: 129-225
Classification Level Classification E-value
Superfamily NTF2-like 0.00000076
Family SnoaL-like polyketide cyclase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra004962
Sequence length 248
Sequence
MVSSSLSFHSIAPIYSGDALRSTFRRNRRQFFSTGVSCRGQSPPTNEPQTTTSKGRAEPE
NVLLKIAWYGSELLGIAASAFRSPASPPPPTTTEQDYEIPVDCSGRAVRVAVVDSIKHDF
KRSYFVTGDLTPAVYEEKCEFADPAGSFKGLARFKRNCTNFGSLIEKSNMKLMKWENFEE
KGVGHWKFSCVMSFPWKPILSATGYTEYYFDRESGKVCRHVEHWNVPKIALFKQLLRPSR
GLMGTTQN
Download sequence
Identical sequences M4CL76
Bra004962 XP_009143214.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]